SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000005432 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000005432
Domain Number 1 Region: 140-265
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.33e-23
Family Voltage-gated potassium channels 0.0025
Further Details:      
 
Domain Number 2 Region: 7-31,79-147
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.49e-22
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000005432   Gene: ENSSHAG00000004745   Transcript: ENSSHAT00000005486
Sequence length 502
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856883.1:119817:186281:-1 gene:ENSSHAG00000004745 transcript:ENSSHAT00000005486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDRGPLLTSAIIFYLSIGAAIFEVLEEPHWKAAKDNYNRQKLKLLQEYPYLGQEGLDKI
LQVVSDATGQGVAITGNQTFNNWNWPNAVIFAATVITTIGYGNVAPKTPAGRLFCIFYGL
FGVPLCLTWINALGKFFGGRAKRLGQFLTKRGVSLRKAQITCTAIFIIWGVLVHLVIPPF
VFMVTEDWDYIEGLYYSFITISTIGFGDYVAGVNPDANYHPLYRYFVELWIYLGLAWLSL
FVNWKVSMFVEVHKAIKKRRRRRKESFESSPHSKKGLQMASSGGVKDVNIFSFLSKKEET
YNDLIKQIGKKGLKSSGGNGERAMGPERGRPALPAAPVGPLAIYTKTRVPSYEEVSQTLR
LKGHISRPQVAEIGEGPPSDNTNSPSTMFVNQLDRISEEEGEAWDARDCHPLIFENANIT
FVNEEGGLSDEDTSKSSLDDNLAGEEEEEQEEGEGPEAERPLNLGEFPSSDDSTFTSTES
ELSVPYEQLMNEYNKINSPRGT
Download sequence
Identical sequences G3VQH7
ENSSHAP00000005432 XP_003769078.1.9362 ENSSHAP00000005432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]