SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000005593 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000005593
Domain Number 1 Region: 1-178
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.41e-54
Family D-ribulose-5-phosphate 3-epimerase 0.00000841
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000005593   Gene: ENSSHAG00000004887   Transcript: ENSSHAT00000005647
Sequence length 187
Comment pep:novel scaffold:DEVIL7.0:GL849897.1:127168:143333:-1 gene:ENSSHAG00000004887 transcript:ENSSHAT00000005647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSRPEQWVKPMAVAGANQYTFHLEATENP
GALIKDIRENGMKVGLAIKPGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVH
WLRTQFPSLDIEVDGGVGPDTIHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAA
QKRSLDR
Download sequence
Identical sequences G3VQY8
ENSSHAP00000005593 ENSSHAP00000005593 ENSSSCP00000017113 ENSSSCP00000017113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]