SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000006288 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000006288
Domain Number 1 Region: 6-38,88-156
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.62e-22
Family Voltage-gated potassium channels 0.0058
Further Details:      
 
Domain Number 2 Region: 164-224
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000000353
Family Voltage-gated potassium channels 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000006288   Gene: ENSSHAG00000005475   Transcript: ENSSHAT00000006342
Sequence length 370
Comment pep:known_by_projection scaffold:DEVIL7.0:GL864918.1:160960:165204:1 gene:ENSSHAG00000005475 transcript:ENSSHAT00000006342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSSGRAMRPTTLLALLALVLLYLVSGALVFRAFEMPKEQQAQSSLGKTRENFLREHPCVN
LSVLQAFIEQVANDLSMGADPGDLTNVSRTAWNLGSAFFFAGTIITTIGYGNMVLLTDEA
RIFCIFYALVGIPLFGMLLAGVGDKLGSSLRRGIGHVEAIFLKWKVQPALVRSLSAMLFL
LVGCLLFVLAPMFVFRYIEGWSTLEALYFIIVTLTTVGFGDFVAGGAREGGSRPFAPGAA
ARRGRAGARQLEQRGALGARGRGGPPPTATPPPPLPEKPKSGPPPTPPAKPGAGPPSLEK
AKPPSSAPTSSVSAPLDYPGENFAFIDESSDTQSERGSVLPRSRRAGLKQPRKPARPRHS
RHGPDKRELA
Download sequence
Identical sequences G3VSY3
ENSSHAP00000006288 ENSSHAP00000006288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]