SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000006441 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000006441
Domain Number 1 Region: 232-431
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.08e-37
Family Pentraxin (pentaxin) 0.00063
Further Details:      
 
Domain Number 2 Region: 26-157
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000102
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 152-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000697
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 4 Region: 190-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000202
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 5 Region: 3-37
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000187
Family EGF-type module 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000006441   Gene: ENSSHAG00000005607   Transcript: ENSSHAT00000006497
Sequence length 436
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841521.1:169266:197971:-1 gene:ENSSHAG00000005607 transcript:ENSSHAT00000006497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FHECFLNPCHNSGTCQQVGRGYVCICLPGFTGLKCEVDVDECSSSPCLNNGMCRDGTGKF
TCQCPAGYTGQLCEGNINECRSNPCLNKGTCVDGINGYHCSCVRGFKGIHCETEVNECQS
NPCLNNAVCEDQIGGFLCKCLPGFQGTRCEKNLDECFSSPCKNGGTCKDGINSFRCLCMA
GYTGTLCEMNINECESNPCKNQATCVDELNTYICKCLPGFSGSQCETEQSAGFNLDFEVS
GIYGYVMLDGVLPSLSAITCTFWMRTSDINNYGTPISYALENGSDNTFLLTDYNGWVLYV
NGKERITNCPSVNDGIWHHISVTWTSTDGSWKVYIDGKLSDGGVGLSIGSAIRGGGALVL
GQEQDKKGEGFNPAESFVGSISQLNIWDYVLAPDQVKSLATSCPEGLSKGNVLAWPDFLS
GVVGKVKIDSKSIFCS
Download sequence
Identical sequences G3VTD6
ENSSHAP00000006441 ENSSHAP00000006441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]