SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000006443 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000006443
Domain Number 1 Region: 733-826
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 5.26e-21
Family Tudor domain 0.0014
Further Details:      
 
Domain Number 2 Region: 972-1063
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 5.11e-19
Family Tudor domain 0.0058
Further Details:      
 
Domain Number 3 Region: 1477-1572
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 8.27e-18
Family Tudor domain 0.0024
Further Details:      
 
Domain Number 4 Region: 1231-1320
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 9.03e-16
Family Tudor domain 0.0073
Further Details:      
 
Domain Number 5 Region: 470-559
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000669
Family Tudor domain 0.018
Further Details:      
 
Domain Number 6 Region: 783-901
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.00000314
Family Staphylococcal nuclease 0.018
Further Details:      
 
Domain Number 7 Region: 27-80
Classification Level Classification E-value
Superfamily RING/U-box 0.0000474
Family RING finger domain, C3HC4 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000006443   Gene: ENSSHAG00000005609   Transcript: ENSSHAT00000006499
Sequence length 1644
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849694.1:169315:295995:1 gene:ENSSHAG00000005609 transcript:ENSSHAT00000006499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPASSSSSSSPPHRLPRRKSRLWGPTEVLCSGCGRSSVAAAAGHYCELQCGHAYCELCLS
VTEEHSTVVCPDCEAVTTINRRQGYYPLDGYAEEDAYEEKFQPKKIRNCSQDFKKTAGQQ
VVGLENSSTLHRPILNPSAVVTETKMTQEIDEALKIAGYNFEQLSDAEKMLECLENQTKQ
ETDCLLEVLEEKFHQLFTSLKSRKRSLYEEVVRNTEDYLGDIIMAKKYIEGKKNDLDAAM
RIARELKMSPSLRTYCDLNQIIRTLKLAFESELSEVSSLKFRSSLRLMNMNCNEIICMFK
NMGKIEFEETSKFRSEENEGSGQNVHKHVNKKESSNCDAYLSVEKNKLEITVTDDEPQSL
VQHEAGDARSETKSTQHQDEKVSVSSPKTVAVLPQMGSSPDVIIEEIIEEDQETYFIEHI
MEAPRHQKKPLQKKSAPFGLKAGSLELVFVSHVIHPCHFYIRKYSQRKNATILEKKLNHF
CNKSLYLSPSDILELGAKIFINSIENGMWCRGTITELIPIENKNVGKPCGLTKYPIRDVA
LMQVFMIDFGNSEVLAVSGVGDGHIVRPGHGALQHLVVNDLCLIIRKPDSYIEALLGDLH
PLALPCSLKDIVPQNSNEGWGEEVKMEFLKMVNNKAVLMKVFREEDGVLIVDLKKPPANK
ISSDMPVSLRDALVFMELARFRSQSPSIPSEQNMTLRYHPPVLPKELSNVSVVVCHINNP
SDFYLQLIESLDFLVLLKKIEEVYKNEDGENLEILCPVQGQACIAKFEDGVWYRAQVIGL
PGHREVEVKYVDFGNAATVTLKEMRKVKDEFLSPPEKAIKCKLAHIEPSKKNKQWSKEAN
EKFEEMTHDKFMTCSVIKILEDNVLSVELFDSISAPGMIPNSVNCQLVKEGLAFYELGYN
LKGNCKKYDEVWDPSPEEIISTETNISNSLVTKFLEDQDLQLLYNKEIPVQISNVVSPEK
IYVQQLSTETLLNSLQEKMATAYENSKCEPVTWEINMYCAVQMTELKQWRRGQVTKIISA
TLVEVMLYDFGIKVTINVDCIRKLEENLKTTRRLALECSLVDIRPTGGSDKWTATACDCL
SFYLTGAVASIIIQESHTTWPLPVKILCRDEKGQCIDISNYLIKKGLALRERRADKINKT
DLSSEKSLDVPMEQESLGVAKYSTSHFEPNKVNGIISEHRVSDIKKTMLDPRTGGCYKPP
VIPNMKVFEAVVSCIGDDGTIYVVPKSSELELRKLMDEIQSNFKCLGLLEPYCWKKGEAC
AIRGSDTVWYRGKVMEVVGGTIRVQYLDHGYTEKIPQCHLYPIVLYADRPQFCIPCQLYN
TVPIGNSWQSDAVELLQELLPKREVEIHNMELPKNPWGKLSVHLYFDGMSLSYFMAHHKH
CTFEGSEEILKEKPKDHSEKYEEENWEINFKELLRSDTETPVLPPYLSPSLPPPGELYPV
QVKHVVSPNEVYICLDLIENFNHQNDTTDTGVSWESEPKSLDEVLQSCNQNVDSLPSLTD
FRSEMPCLAEYNDGLWYRAKILSIKEFDPLAILVQFVDYGSTEKLPTSRLRQIPLHLMKY
PARAVKVLLAGFKPPLKDSEKTRIPYCPKWSMEAMWAMIDCLQGKQLYASSLTQSPEYIV
TLYEDEQYPVHMSLIEMGLADLDE
Download sequence
Identical sequences G3VTD8
ENSSHAP00000006443 ENSSHAP00000006443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]