SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000006483 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000006483
Domain Number 1 Region: 221-256
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000118
Family EGF-type module 0.012
Further Details:      
 
Domain Number 2 Region: 73-112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000291
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 545-829
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000192
Family Rhodopsin-like 0.029
Further Details:      
 
Domain Number 4 Region: 169-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000686
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000006483   Gene: ENSSHAG00000005642   Transcript: ENSSHAT00000006539
Sequence length 840
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841415.1:171049:198302:-1 gene:ENSSHAG00000005642 transcript:ENSSHAT00000006539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNSHIPPLSISGLCVLVLLKIAVFQNTKDSQCRRRGCPQNAICVNKTHCACEDGFVTTSG
EKYFSDFLEICDDVNECVPPIKIFCGMNADCVNTYGSYHCTCIPGYALPSGEKNFPNASM
NNCQEDVKERQGFPIMAQGRMLFSLYQTFTHKFLLSFSLCNLCNVSEAADINECALSNDT
CGENAECVNENKGYHCTCIEGYALPSGRLSPSPRVYICEKDKNECQNKSLCEPNGVCENT
VGSYVCKCKPGFVHSRENPAECVGITPGPPAEEISIPSWKPPPEVQQSCFPFLQDFLSHL
SSMPSKFKAASAQNSIENFVQDMEQLLKISQNMEHLPVEIRLQVATYMLSITEHILRDLA
QAMPNGGAVFHTKNGTELSLKIMDKPMGITEIGRSHAKMALDWNLALKDDGSEPAVVGLF
STSNMEKLLAQAPLVLDPEKQAHLQEVNEGPVKGGIPVLLSAVSTAFLSNKNTAYLNPPV
TFAFTHSKKPSLKPRQEVICAFWQHNNNGSGHWATAGCRRVGTNESSTTCSCNHLSSFAI
LVAHYEVEDWTLSVITQVGLSVSLVCLLLCILTFLLCRSIQGSRTTIHLHLCLCLFVGSA
VFLAGSTNPGQGAQVGLRCRLVAGLLHYCFLAAFCWMCLEGLELYFLVVREFPGPGLRTR
WLCLLGYGTPALIVAISAAVYSQGYGRPRYCWLSLKNGFIWSFLGPITLIIAFNAFIFVV
TVWKLTQKFSEINPDMKKLKKARMLTFTAIAQLCILGCTWIFGLFLFGPQSQVLVYIFTI
LNCFQGCFLFLLHCLLNKKVREEYRRWACIVTKSKYNEFSTSTTSQSQSRALRPSLESGM
Download sequence
Identical sequences G3VTH8
ENSSHAP00000006483 ENSSHAP00000006483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]