SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000006501 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000006501
Domain Number 1 Region: 66-127
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-24
Family KRAB domain (Kruppel-associated box) 0.00089
Further Details:      
 
Domain Number 2 Region: 586-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.7e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 474-531
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 4 Region: 530-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-22
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 5 Region: 670-727
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 6 Region: 866-923
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.34e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 782-839
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-21
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 8 Region: 726-783
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 9 Region: 418-475
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000012
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 10 Region: 366-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000142
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 11 Region: 633-665
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000553
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 12 Region: 829-861
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000398
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000006501   Gene: ENSSHAG00000005657   Transcript: ENSSHAT00000006557
Sequence length 933
Comment pep:novel scaffold:DEVIL7.0:GL857376.1:172982:179491:-1 gene:ENSSHAG00000005657 transcript:ENSSHAT00000006557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPMLLPATLCQLVGAPARDPEVPEEDVCPGPLHLGGPETCRSQEPLGATERRNIRAESG
GQRGLVSQEPVTFQDVAVVFTQEQWACLDPSQKALYRDVMLETYQNLLCLGLTGCKPRMI
HQLEQGEAPWMPERRVLDSSRPDWETRPENKASTAKLGFLIEQLGSKKLIGDVLCLYNLK
EDWEIDARLGSHQSIEMNDSQQEKITQTEILNEARSHECTTFSQNIGIKPNLFSQYKMSL
GKNLYKYASPRKSFLPLSDQNKYNIYSKKIFSQYNEYGKSFTSQSDFIDSFSLYPGEKIN
EYKECGKDTNLSLFITCHQTIDIGEKISKFSNFEGASSESVKFFEHQRTCTGDKPYEYNK
CKSVNHSSYLSYHERIFTEKKSYECNDCGKVFFESRMLTHQRTCIGEIPYKCNECKKAFP
QSSGVTHIQIINSVEKSYKCKHCWKTFCQKGQLIEHERTHIGEKPYKCDQCEKTFSQSTR
LSQHHRIHTGEKPFKCNHCGKTFSARRSLTQHQRIHTGEKPYKCDQCEKTFHQSTHLSQH
QRIHTGEKPYKCNHCWKAFRQRGQLTEHERTHTGEKPYKCDQCEKTFHRSTHLSQHQRIH
TGEKPFECNHCGKTFSARQSLTQHQRIHTGEKPYKCDQCEKTFHQSTHLSQHQRIHTGEK
PYKCNYCWKAYRQRGQLTEHERIHTGEKPYKCDQCEKTFHRSTHLSQHQRIHTGEKPFEC
NRCEKTFSTRQSLTQHERIHTGERPYECNECRKTFHVKKELTQHQRIHTGEKPYKCYHCR
KAFRLSTQLTQHQRIHTGDKPFCCNHCGKTFRLSTQFIRHQRIHTGEKPYRCNHCWKAFS
LRGQLTEHERTHTGEKLYKCDQCEKTFHRSIHFSQHQRIQTGEKPFECHQCRKSFFQRIH
LTRHQRIHTGEKPYKCDQCGKTFGQKGNLTQSA
Download sequence
Identical sequences G3VTJ6
ENSSHAP00000006501 ENSSHAP00000006501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]