SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000006882 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000006882
Domain Number 1 Region: 2044-2115
Classification Level Classification E-value
Superfamily TB module/8-cys domain 9.42e-19
Family TB module/8-cys domain 0.0000985
Further Details:      
 
Domain Number 2 Region: 2122-2256
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.18e-18
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 946-1013
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.44e-18
Family TB module/8-cys domain 0.0007
Further Details:      
 
Domain Number 4 Region: 710-849
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.43e-18
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 5 Region: 2329-2401
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.22e-17
Family TB module/8-cys domain 0.00056
Further Details:      
 
Domain Number 6 Region: 1020-1151
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.82e-17
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 1107-1245
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.06e-17
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 8 Region: 1841-1967
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.16e-17
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 9 Region: 533-656
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.57e-17
Family Growth factor receptor domain 0.0092
Further Details:      
 
Domain Number 10 Region: 1520-1593
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.7e-16
Family TB module/8-cys domain 0.0000603
Further Details:      
 
Domain Number 11 Region: 302-371
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.7e-16
Family TB module/8-cys domain 0.0016
Further Details:      
 
Domain Number 12 Region: 651-724
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.62e-16
Family TB module/8-cys domain 0.00071
Further Details:      
 
Domain Number 13 Region: 445-575
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.92e-16
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 14 Region: 155-240
Classification Level Classification E-value
Superfamily TB module/8-cys domain 6.15e-16
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 15 Region: 1680-1746
Classification Level Classification E-value
Superfamily TB module/8-cys domain 7.72e-16
Family TB module/8-cys domain 0.00053
Further Details:      
 
Domain Number 16 Region: 843-927
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000249
Family TB module/8-cys domain 0.0016
Further Details:      
 
Domain Number 17 Region: 2442-2572
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000487
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 18 Region: 1403-1530
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000863
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 19 Region: 1235-1359
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000377
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 20 Region: 201-312
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000298
Family Growth factor receptor domain 0.0076
Further Details:      
 
Domain Number 21 Region: 1599-1654
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000285
Family EGF-type module 0.00051
Further Details:      
 
Domain Number 22 Region: 2569-2686
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000424
Family Growth factor receptor domain 0.0097
Further Details:      
 
Domain Number 23 Region: 2005-2057
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000888
Family EGF-type module 0.005
Further Details:      
 
Domain Number 24 Region: 2400-2448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000175
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 25 Region: 2282-2331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000748
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 26 Region: 1758-1814
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000469
Family EGF-type module 0.0028
Further Details:      
 
Domain Number 27 Region: 1357-1405
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000143
Family EGF-type module 0.036
Further Details:      
 
Domain Number 28 Region: 1960-2003
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000244
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 29 Region: 1801-1839
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000503
Family EGF-type module 0.01
Further Details:      
 
Domain Number 30 Region: 2243-2283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000318
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000006882   Gene: ENSSHAG00000005977   Transcript: ENSSHAT00000006941
Sequence length 2856
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841426.1:195570:293074:1 gene:ENSSHAG00000005977 transcript:ENSSHAT00000006941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGAIRADKPGSEEAPALSRVRRRGFDTLRGPNVCGSRFHSYCCPGWRTLPGGNQCIVPIC
RNSCGEGFCSRPNLCACANGQLSPSCGASGVTPCSVIVCPLATVIAKHIECKTKRYIESS
CQRAVCEQSCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQVCQGQLSGLVC
TKTMCCASVGRAWGHPCEPCPAQPHPCRRGFIPNIRTGACQDVDECRAIPGLCQGGNCIN
TVGSFECRCPAGHRLGEASHKCEDVDECSTIPGICEGGECANTVGSYVCTCPRGFMASAD
GSHCLDQRIGTCFSALLGGRCAGELPGQASKRQCCCEWGRCWAIGSTPEMCPQRGSDEFR
RLCVEGPPVLPAYPGHFPGLPGFGPNGLGPGLTGPARHGPHGTNGQGSLPSLPGLGPGSS
SIGKDQSKADGSHLRGPLLLGTATLNQTIDICKHFTNLCLNGRCLPTSSSYRCECNMGYK
QDVRGECIDVDECSSSPCVHGDCVNTPGSYHCKCQEGFQSTPTKQSCVDIDECLLNGGMC
RHGRCINTEGSFQCICNAGFEITPDGKNCVDHDECATTTMCLNGVCLNEAGSFKCLCKPG
FLLAPSGRYCVDIDECETPGICMNGWCINTEGSFRCECVGGLAIGADGRVCVDTHMRSTC
YGAIKKGTCARPFPGAVTKSECCCTSPDHGFGEPCQPCPAKNSDEFQALCSSGLGITADG
RDINECALNPDICPNGVCENLRGSYRCICHLGYEADPPGKECVDVDECALNRLLCDNGLC
RNTPGSYTCTCPTGFTFKTETDSCEDIDECLSNPCVNGLCRNHAGSFACECSPGSRLDPA
GNVCVDSMKGTCWLQIQDGRCEANINGATLRSECCATLGAAWGSPCQLCETDPACSRGFA
RMKGLTCEDVNECEVFPGVCPNGRCLNTAGSFRCECPEGLTLDSTGRVCVDVRVEQCFLK
WDEDECLAPLSGKYRMDMCCCSVGAAWGTGCEACPEPGSPEFALICPRGWGLVSPASLPN
VTPDVNECKAFPGLCTHGSCRNTVGSFRCVCGNGFALDAQERNCTDIDECRISPDLCGHG
TCVNTLGSFECECFQGYESGFMMMKNCMDIDECARDPLLCRGGTCVNNDGSYQCLCPPGH
ELSVDGNACEDVNECSLRDNLCRHGRCVNVIGTYQCACDTGFQSTPDRQGCIDTDECSVG
NGGCESQCTNTEGSYQCSCGEGYALMPDGRACADIDECEENPDICDGGQCTNVPGHHRCL
CYDGFMATLDMKTCIDVNECDLNPNICLHGDCENSKGSFICHCQLGYFVKKGTTGCTDID
ECAVGAHNCDARASCVNVPGTFRCMCQSGWVGDGFKCHDLDECATEDHGCHINADCVNSP
GSHRCVCREGFSGDGFSCVDRDECADNVNLCENGQCLNAPGGYRCECEMGFNPTEDSRAC
QDIDECTFQNICVFGSCHNLPGMFRCVCDDGYELDRSGGNCTDINECADPVNCINGLCVN
TPGSYLCNCPQDFELNPSGVGCVDTRVGNCFLDTQDRGDGGISCSAEIGVGVTRASCCCS
LGRAWGNPCELCPPGNTTEYKTLCPGGEGFRPNPITVILEDIDECQELPGLCQGGDCVNT
FGNFQCECPLNYYLNEDTRICEDIDECSTHVGICGPGTCYNTLGNYTCVCPPEYMQVNGG
NNCMDVRKSVCYRHHNDTCENELAFNMTRKMCCCSYNIGKAWNRPCEPCPAPASSEYQIL
CGNQAPGFIIDIHTGKPIDIDECSEIPAICTNGVCINQIGSFRCECPVGFSYNSVLLVCE
DMDECSSGESPCQRHADCINIPGSYRCECARGYKLSPSGACVGRNECQEIANVCSHGDCV
DTEGSYACICHQGFKATVDQTMCMDIDECDRQPCGNGTCKNTVGSYNCLCFPGFELTHNS
DCMDIDECTSLTGQVCRNGQCINSIGSFQCLCHEGYERTTDGKNCVDINECVSFPGTCSP
GTCQNLDGAFRCICPPGYQVQDDSCIDINECDEEPNLCLFGTCTNSPGSFQCLCPPGFVL
SDNGRRCFDTRQSFCFTRFENGRCSVPKAFNTTKARCCCSKMPGEGWGDPCELCPQEGSG
AFQELCPFGHGAVPGPDDSREDVNECSENPGICVNGVCINTDGSFRCECPFGYSLDYTGV
NCVDMDECSVGNPCGNGVCSNVVGGFECTCDEGFEPGPMMTCEDINECSLNPLLCAFRCI
NTKGSYECTCPSGYMLREDRVMCKDLDECAEGLHDCPARGMLCKNLIGTFTCICPPGLQL
RAHGEGCTDENECRTQPGLCSNGRCVNTVGSYHCDCNEGFQASPTGTECLDTRQGSCFTE
VLQTTCQLSSTNHNPVTKAECCCDGGRGWGSLCELCPLPGTAQHRKMCPHGPGYTTDGRD
IDECKVLSNLCQNGQCINTIGSFRCHCETGYTPDIAGTACVDVDECEQSPKPCNFLCKNT
EGSFKCSCPRGYLLQGNGKTCKDLDECSTKQHNCQFLCVNTVGSFTCKCPPGFTQHHHSC
LDSDECMAQPGLCGAQGLCENTPGSYSCQCQRGFSLDSTGLSCEDVDECDGSHHCQHGCR
NMVGSYRCGCPNGFTPHSQWDQCVDDNECSSPTACGSASCYNTLGSFKCVCPSGYDFDQA
FGGCRDVDECSAGGSPCSYGCSNTNGGYLCGCPGGYFRAGQGHCISGLGFDKNSYLPTLA
EEENEDNLLSPDTCYECKINGYSQRSRQRRHTNGTQRHQFSSPQMSLASVDTEAPLAMAL
NLSKLGPREHILEFLPALEALENRVLYIIAHGNEGGFFRMQHKEGLSYLRLGRKKPGPGA
YELEVMSVPRPPGDDLGEQAEEGGQALRLKLQLQLY
Download sequence
Identical sequences G3VUM7
ENSSHAP00000006882 ENSSHAP00000006882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]