SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000007055 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000007055
Domain Number 1 Region: 348-480
Classification Level Classification E-value
Superfamily C-type lectin-like 3.95e-41
Family C-type lectin domain 0.0000893
Further Details:      
 
Domain Number 2 Region: 207-342
Classification Level Classification E-value
Superfamily C-type lectin-like 2.44e-37
Family C-type lectin domain 0.00042
Further Details:      
 
Domain Number 3 Region: 489-627
Classification Level Classification E-value
Superfamily C-type lectin-like 8.94e-34
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 4 Region: 938-1085
Classification Level Classification E-value
Superfamily C-type lectin-like 1.6e-33
Family C-type lectin domain 0.00075
Further Details:      
 
Domain Number 5 Region: 800-926
Classification Level Classification E-value
Superfamily C-type lectin-like 4.37e-31
Family C-type lectin domain 0.00054
Further Details:      
 
Domain Number 6 Region: 638-786
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-27
Family C-type lectin domain 0.00044
Further Details:      
 
Domain Number 7 Region: 1232-1366
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-26
Family C-type lectin domain 0.0034
Further Details:      
 
Domain Number 8 Region: 1097-1223
Classification Level Classification E-value
Superfamily C-type lectin-like 3.04e-26
Family C-type lectin domain 0.002
Further Details:      
 
Domain Number 9 Region: 11-144
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.45e-22
Family Cysteine rich domain 0.0025
Further Details:      
 
Domain Number 10 Region: 144-202
Classification Level Classification E-value
Superfamily Kringle-like 2.03e-20
Family Fibronectin type II module 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000007055   Gene: ENSSHAG00000006131   Transcript: ENSSHAT00000007117
Sequence length 1449
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856831.1:207087:247082:1 gene:ENSSHAG00000006131 transcript:ENSSHAT00000007117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHFLPSFLEPNIFLIFTHGLQGCLEAQEGQVKVTPVCNTSLPAQQWKWVSRNRLFNLGA
MQCLGTAWPGANTTTVTSLGTYECDREALSLRWYCRTLGDQLSLYLGGQTGNTSKTTVSD
RGDQTRGNQWRIYGSDEDLCSVPYYEIYTIQGNSHGKPCTIPFKYDNQWFHGCTSTGRED
GHLWCATTQDYGKDERWGFCPIKSNDCETFWDKDQLTNSCYQFNFQSTLSWREAWASCEQ
QGADLLSITEIHEQTYINGLLTGYSSTLWIGLNDLDTNGGWQWSDNSPLKYLNWESDQPD
NPSEENCGVIRTESSGGWQNRDCSIALPYVCKKKPNATVETSLQPDSWTGVKVECEPSWR
PFQSHCYRLLQEKRSWHESKKACLRGGGDLLSIHSLAELEFITKQIKQEVEELWIGLNDL
KLQMNFEWSDGSLVQFTHWHPFEPNNFRDNLEDCVTIWGPEGRWNDSPCNQSLPSICKKA
GQVSLGTPEEDHGCRKGWTWHSPSCYWLGEDYVTYSEARRMCMDQGATLVTIMNRFEQAY
VSSLIYSWDGKYFWTALQDINGTGSFHWLSGDEVVYTHWNRDQPGYSRGGCVALATGSAM
GLWEVKNCSTFRARYICRQNLGTPVTPELPGPDPTPGLTGFCPQGWASDLKLRHCYKVFS
SDRLQDKKSWPLAQSACRELGAQLLSLASYEEEHFVSNMLNKIFGESEPEIQEQHWFWIG
LNRRDPRAERSWRWSDGLGYSYHNFDRSRHDDDDIRSCAVLDLASLQWVAMQCETHLDWI
CKLPKGVNIKEPDVNPQGWKEWIRFQEADYKFFDHHSTWGQAQRICTWFQAELVSVHSQA
ELDFLGHSLQKFTRGQEQHWWIGLHTSENDGRFRWTDKSIINFISWAPGKPRPIGKDKKC
VYVTASREDWGDQRCLTALPYICKRSNITSGKSPLDPPISLLPGGCPTGWSQFINKCFRI
QGHDPAERVKWSEAQHMCEQQGAQLATIANPLEQAFITAKLLNVTFDLWIGLHATQKEFQ
WVGQEPMLYGNWAPGEPSGHSDSASGEKPTNCVVIGHSSSAHFTGRWDDRNCLEETHGFI
CQKGIDPSLNPSPDALPPAPGTQLSYHNSVFRLLQKPLRWHDALLLCESLNSSLAEVDNP
YTQAFLTQATRSLHIPLWIGLSDEEGSRRYSWVLDELSYTNWKDGEPQFLGGCGYLDVDG
TWRTASCDTKLQGAVCGVKQEFQPPRKVSYCPHALADSAWIPFREHCYSFHMELMLGHKE
ALQRCQKAGGAILSIMDEMENVFVWEHMQSTEGQSGGAWLGMNFNPKGGTLVWHDNTAVN
YSNWGPPGLGPSMLSHNSCYWIQSSSGLWRPGGCTNITMGVVCKLSQVKEGSFSSSALQE
NPTALVVVVLAALVLLGLLAVAALLYRRRRNPERGAFESARYSRSSSGPGEVAEKNILVS
DMEMNEQQD
Download sequence
Identical sequences G3VV50
ENSSHAP00000007055 ENSSHAP00000007055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]