SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000007250 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000007250
Domain Number 1 Region: 555-778
Classification Level Classification E-value
Superfamily GFP-like 9.31e-76
Family Domain G2 of nidogen-1 0.000000963
Further Details:      
 
Domain Number 2 Region: 1136-1392
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-42
Family YWTD domain 0.0000000923
Further Details:      
 
Domain Number 3 Region: 1043-1113
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.14e-19
Family Thyroglobulin type-1 domain 0.00082
Further Details:      
 
Domain Number 4 Region: 513-551,790-887
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.88e-16
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 5 Region: 913-958
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000528
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000007250   Gene: ENSSHAG00000006301   Transcript: ENSSHAT00000007312
Sequence length 1404
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834895.1:218985:318832:-1 gene:ENSSHAG00000006301 transcript:ENSSHAT00000007312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVERDTVQKRQVLLLLLHLHWLVPLSSALHPQDLFQYGEAWGDQFLQEGDDESSSLVKL
KRPLRFYEAQFNSLYVGTNGIISTQDFPRERQYVNDVFPTEFPAIAPFLSDLDTSNGRGK
ISYREDDSVEILNKAALYIRTGFPKTARNFTPTHAFLATWEEVGAYEKVMHNVLPSRLNN
TFQVVLTFDEFDTYALFLYPTNGLQFFATRPKESYDTQLELPARVGFSQGKDDYQKKEGL
HFSVTSTEQSVKNLYQISNLGIPGVWAFHIGSTFRLNNVEPANFRGNLSINHSLEHFLTN
AEEYSVLESNYAEDKMNYVGSFYNEVNMMNDESEHSPNGQELVSNSHSKTEILLDLNDSS
HSQESELKFKLLSPPPSHIPLSLKTESDLLHHQIEKGAQGEEVFLISQSNTASSQQRGIK
NPAPPDTKGEFLDLLKEASPSYLKNETIQPYPDSGTMSSEMEALSDYSEGGVLTNYPFPE
NKLPLNHGRYIMGMEEDSNFSTNVSIHQAASKETCEQNHSQCSQHAFCTDYSTGFCCHCQ
SKYYGNGKHCLLEESPHRVNGKVSGHLHVGQTPVSFSEVDLHAYIVGNDGRAYIAISHIP
HLAAQALLPLTPIGGLFGWLFALEKPGYENGFSITEGATFSNHMDITFYPGEEKVHIIHT
AEGLDSENYLSVKTNIQGKVPFIPANFTAYIAPYKEIYHYSNLAVTSTTSREYYLSFGEI
NQTFSYHLHQNITYQDCKHTPNPRIVPTTQQLNVDRIFALYNEEEKVLRYAMTNQIGPKE
GDKDPSMTNPCYDGSHACDIRAQCLVGTGLGYSCECTTGYQGDGRSCFDVNECTTGSHLC
GPNSVCVNLPGSYRCECQSGYEFGEDKHTCILIASSFNPCEEGNHNCASVEKAQCIYHGG
SSYSCICLSGYVGNGHECTDVDECIEERCHPAAACYNVPGSFSCHCQHGYKGDGFQCFPE
VIDDMHIYKGKICMYVYMYTYARHLFIHTHIYIYHMLRKWPFPLLCASSIFCCIQRIVGR
IRGWSKTSQGHFGGRGREESTQGPQTVCERWRESLLEHYGGRPREDQYVPQCDEFGHFNP
LQCHGNSNYCWCVDKNGREVEGTRSQPGITPACIPSIAPPTILPSPYPNVIPPSVGTFLL
YAQGQQIGYLPLNGTRLQKETAKTLLSLHGSIAVGIDYDCQEKMVYWTDVAGRVISRASL
ELGNEPEIVISSGLMSPEGLAIDYFHRTMFWTDSGLDKIESAKLDGSERKVLFDTDLVNP
RAIAVDPIRGNLFWTDWNREGPKIETSSIDGTNRRILVNKDIGLPNGLTFDPFSKLICWA
DAGTKKLECALSNGTGRHIIQNNLNYPFSIVSYANHFYHTDWRRDGVIAVNKENGQFTDE
YLPEQRSHLYGITAIYPYCPKVTK
Download sequence
Identical sequences G3VVP5
ENSSHAP00000007250 ENSSHAP00000007250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]