SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000007251 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000007251
Domain Number 1 Region: 568-790
Classification Level Classification E-value
Superfamily GFP-like 3.77e-78
Family Domain G2 of nidogen-1 0.0000009
Further Details:      
 
Domain Number 2 Region: 1069-1325
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-42
Family YWTD domain 0.0000000923
Further Details:      
 
Domain Number 3 Region: 941-1046
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.35e-22
Family Thyroglobulin type-1 domain 0.00082
Further Details:      
 
Domain Number 4 Region: 526-564,802-899
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.2e-16
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 5 Region: 888-937
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000778
Family EGF-like domain of nidogen-1 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000007251   Gene: ENSSHAG00000006301   Transcript: ENSSHAT00000007313
Sequence length 1336
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834895.1:219188:318832:-1 gene:ENSSHAG00000006301 transcript:ENSSHAT00000007313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGVPDSGLVVLGCGFALLLKQSREHTMKVERDTVQKRQVLLLLLHLHWLVPLSSALHPQ
DLFQYGEAWGDQFLQEGDDESSSLVKLKRPLRFYEAQFNSLYVGTNGIISTQDFPRERQY
VNDVFPTEFPAIAPFLSDLDTSNGRGKISYREDDSVEILNKAALYIRTGFPKTARNFTPT
HAFLATWEEVGAYEKVMHNVLPSRLNNTFQVVLTFDEFDTYALFLYPTNGLQFFATRPKE
SYDTQLELPARVGFSQGKDDYQKKEGLHFSVTSTEQSVKNLYQISNLGIPGVWAFHIGST
FRLNNVEPANFRGNLSINHSLEHFLTNAEEYSVLESNYAEDKMNYVGSFYNEVNMMNDES
EHSPNGQELVSNSHSKTEILLDLNDSSHSQVDHSEPKHESDLLHHQIEKGAQGEEVFLIS
QSNTASSQQRGIKNPAPPDTKGEFLDLLKEASPSYLKNETIQPYPDSGTMSSEMEALSDY
SEGGVLTNYPFPENKLPLNHGRYIMGMEEDSNFSTNVSIHQAASKETCEQNHSQCSQHAF
CTDYSTGFCCHCQSKYYGNGKHCLLEESPHRVNGKVSGHLHVGQTPVSFSEVDLHAYIVG
NDGRAYIAISHIPHLAAQALLPLTPIGGLFGWLFALEKPGYENGFSITGATFSNHMDITF
YPGEEKVHIIHTAEGLDSENYLSVKTNIQGKVPFIPANFTAYIAPYKEIYHYSNLAVTST
TSREYYLSFGEINQTFSYHLHQNITYQDCKHTPNPRIVPTTQQLNVDRIFALYNEEEKVL
RYAMTNQIGPKEGDKDPSMTNPCYDGSHACDIRAQCLVGTGLGYSCECTTGYQGDGRSCF
DVNECTTGSHLCGPNSVCVNLPGSYRCECQSGYEFGEDKHTCILIASSFNPCEEGNHNCA
SVEKAQCIYHGGSSYSCICLSGYVGNGHECTDVDECIEERCHPAAACYNVPGSFSCHCQH
GYKGDGFQCFPESTQGPQTVCERWRESLLEHYGGRPREDQYVPQCDEFGHFNPLQCHGNS
NYCWCVDKNGREVEGTRSQPGITPACIPSIAPPTILPSPYPNVIPPSVGTFLLYAQGQQI
GYLPLNGTRLQKETAKTLLSLHGSIAVGIDYDCQEKMVYWTDVAGRVISRASLELGNEPE
IVISSGLMSPEGLAIDYFHRTMFWTDSGLDKIESAKLDGSERKVLFDTDLVNPRAIAVDP
IRGNLFWTDWNREGPKIETSSIDGTNRRILVNKDIGLPNGLTFDPFSKLICWADAGTKKL
ECALSNGTGRHIIQNNLNYPFSIVSYANHFYHTDWRRDGVIAVNKENGQFTDEYLPEQRS
HLYGITAIYPYCPKVE
Download sequence
Identical sequences G3VVP6
ENSSHAP00000007251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]