SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000007367 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000007367
Domain Number 1 Region: 3-67
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.19e-19
Family TB module/8-cys domain 0.0000766
Further Details:      
 
Domain Number 2 Region: 174-223,257-271
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000105
Family TB module/8-cys domain 0.0024
Further Details:      
 
Domain Number 3 Region: 80-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000873
Family EGF-type module 0.012
Further Details:      
 
Domain Number 4 Region: 120-163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000227
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 5 Region: 259-295
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family EGF-type module 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000007367   Gene: ENSSHAG00000006404   Transcript: ENSSHAT00000007429
Sequence length 295
Comment pep:known_by_projection scaffold:DEVIL7.0:GL864985.1:227253:231244:-1 gene:ENSSHAG00000006404 transcript:ENSSHAT00000007429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQEKKECCLSFDDTIFCDSVLATNVTQQECCCSLGAGWGDHCEIYPCPVYSSAEFHSLCP
DGKGYIQENNIINYGIPAHRDIDECVLFGEEICKEGKCVNTQPGYECYCKQGFYYDGNLL
ECVDVDECLDESKCRNGVCENTRGGYRCSCTPPAEYSPAQRQCLIPEEMDRPQERRDVCW
GQRGDDGMCAGPLAGPLLPYEECCCRQGRGWGAQCRPCPPRGPGLQCPNSQSESNSFWDV
SPLFLRKPHRAEEDSSEEDSDECRCVSGRCVARPGGAVCECPGGFQLDASRTRCV
Download sequence
Identical sequences G3VW12
ENSSHAP00000007367 ENSSHAP00000007367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]