SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000007935 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000007935
Domain Number 1 Region: 174-222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000362
Family EGF-type module 0.016
Further Details:      
 
Domain Number 2 Region: 119-266
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000722
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000007935   Gene: ENSSHAG00000006883   Transcript: ENSSHAT00000007998
Sequence length 540
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834443.1:270847:297589:1 gene:ENSSHAG00000006883 transcript:ENSSHAT00000007998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEVLCCLIHLCEPLVPLDPCSAYISLNEPWRNTDHQLKEEEGQPTCDSNVDGEWYRFTGM
AGDAMPTFCIPENHCGTHAPIWLNGNHPQEADGIVQRQACASFNGNCCLWNNTVEVKACP
GGYYVYRLTKPSVCFHAYCGHFYDICDVVDCHGTCSNSECTCSEGTVLGPDQQTCLDENE
CEKNNGGCSEICVNLKNSYRCECGVGRVLGSDGKTCEDIEGCQNKNGGCSHFCRGYGNTY
QCECPRGLVLSEDNHTCQVPMRCQSNAIEVNIPKDLVGGLEVFLTNTSCRGVSNGTHINI
YFSLKTCGTVVDVVNDKIIASNLVTGLPKQMPGSNGDIIIRTSKLLIPVICEFPRLYTIS
EGYVPNLRNSPLEIMGRSQGIFPFTLEIFKDNEFEEPYRETLPTLKLRDLLYFGIEPLVH
VNGLETLVESCFATPTDKIDEILKHYLIRDGCVSDDSVKQYTSRDHLTKHFQVPVFKFVG
KDHQVVFLHCRVLVCGVLDEQSRCAQGCNRRMRREAIKEQGAHLQNHVLTSGPIIIDRED
Download sequence
Identical sequences G3VXN0
ENSSHAP00000007935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]