SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000008039 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000008039
Domain Number 1 Region: 6-197
Classification Level Classification E-value
Superfamily vWA-like 7.72e-55
Family Integrin A (or I) domain 0.00017
Further Details:      
 
Domain Number 2 Region: 241-288
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000628
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 3 Region: 201-248
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000774
Family EGF-type module 0.019
Further Details:      
 
Domain Number 4 Region: 279-323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000215
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000008039   Gene: ENSSHAG00000006973   Transcript: ENSSHAT00000008103
Sequence length 423
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834799.1:273630:288439:1 gene:ENSSHAG00000006973 transcript:ENSSHAT00000008103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEGAGRGGEVCRSRPLDLVFIIDSSRSVRPQQFAKVKSFVAKIIESLDIGASATRVALVN
YASTVKIEFSLQTYSDKASVKQAVSRVIPLSTGTMSGLAIQKAMDEAFAVEAGARAASSN
IPKVAIMVTDGRPQDQVEEVAARARAAGIEIYAVGVDRADMQSLRTIASRPLDDHVFYVE
TYGVIEKVTSKFRETFCALDQCALGTHQCEHVCVSDGGGAHHCKCSQGYTLNEDKRTCSA
IDKCALNTHGCEHICVSERAGGYHCECYEGYFLNEDKKTCSAQDRCALGTHQCQHICVSD
GAGAHHCQCYEGYSLNPDKKTCSGRKGGGLARKTVSTCVCVCVSVGRGASRCRCRPGFIL
QGDGRSCAAVEEARRLVSTQDACSCDATLAFQEKVTSYLQRLSELLDDILEKLQVNDLRQ
VRR
Download sequence
Identical sequences G3VXY4
ENSSHAP00000008039 ENSSHAP00000008039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]