SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000008235 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000008235
Domain Number 1 Region: 69-465
Classification Level Classification E-value
Superfamily Serpins 1.2e-133
Family Serpins 0.0000000000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000008235   Gene: ENSSHAG00000007135   Transcript: ENSSHAT00000008302
Sequence length 468
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856752.1:288329:303855:-1 gene:ENSSHAG00000007135 transcript:ENSSHAT00000008302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLLPPIGNCVALFRKLCLLSLLLAGFWGCVSSHWNPVGDICTAKPRDIPVNPMCIYRHPE
KKLSEEGGSEQKKAPELTNPRVWELSEANSRFATELYKQLAASKDHNENIFMSPLSISTA
FAMTKLGACNNTLKQLMEVFKFDTISEKTSDQVHFFFAKLNCRLYRKANKSSELVAANRL
FGEKSLIFNETYQDISEVVYGAKLKPLNFKEDPELSRVTINDWVSNKTEGLITDVIPKGA
ITDLTVLVLVNTIYFKGWWKSKFSQENTKEEPFYKADGEQCSALMMYQENKFRYSHVKGS
SQVEVLELPYKGDDITMVLILPKPDKPLDKVERDLTPDILREWLESLQETLLAVHVPRFR
IEDNFSVKENLQEMGLKDLFHPERAELPGIIAEGQGDLFVSDAFHKAFLEVNEEGSEAAA
STSVVISGRSLNFNRVTFNANRPFLVLIREVALNTIIFMGRISNPCMN
Download sequence
Identical sequences G3VYI0
ENSSHAP00000008235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]