SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000008692 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000008692
Domain Number 1 Region: 416-520
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.05e-29
Family MBT repeat 0.0009
Further Details:      
 
Domain Number 2 Region: 291-392
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.52e-28
Family MBT repeat 0.00088
Further Details:      
 
Domain Number 3 Region: 181-288
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.02e-23
Family MBT repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000008692   Gene: ENSSHAG00000007530   Transcript: ENSSHAT00000008764
Sequence length 521
Comment pep:known_by_projection scaffold:DEVIL7.0:GL861723.1:325151:338772:1 gene:ENSSHAG00000007530 transcript:ENSSHAT00000008764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SERMEEEEEEDDDDEEEEEEEEELDLFGGYDSFRSYNSSLGSESSSYLEESSDNENELND
REAGELPTSPLLIPSPNTPRSQDGSGSEPAVCEMCGIVGTREAFFSKTKRFCSVSCSRSY
SSNSKKASILARLQGKPPTKKAKVLHKAAWSAKIGAFLHSQGTGQLADGTPTGQDALVLG
FDWGKFLKEHNYKAAPVSCFKHVPLFDQWDDVVKGMKVEVLNNDAVLPSRVYWIASVIQT
AGMRRALLGSRHLSQDFWCNLGTVDVHPIGWCAINSKILVPPQTIHAKYTDWRSYLMKRL
VGARTLPVDFHIKMAESMKYPFRQGMRVEVVDKTHVSRTRMAVVDTVIGGRLRLLYEDGD
GDDDFWCHMWSPLIHPVGWSRRVGHSIKKPGGESTARPEPTPLPLPLPKVRAVYTEGGWF
EEGMKLEAIDPLNLGNICVATVCKVLLDGYLMICIDGSPSVDDSDWFCYHASSHAIFPAT
FCQKNAIDLTPPKGYDPKTFDWASYLEETNSKAAPARLFNM
Download sequence
Identical sequences G3VZT7
ENSSHAP00000008692 ENSSHAP00000008692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]