SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000008789 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000008789
Domain Number 1 Region: 274-348
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000000432
Family Rhamnogalacturonase B, RhgB, middle domain 0.026
Further Details:      
 
Domain Number 2 Region: 72-150
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000432
Family Rhamnogalacturonase B, RhgB, middle domain 0.024
Further Details:      
 
Domain Number 3 Region: 907-992
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000706
Family Carboxypeptidase regulatory domain 0.02
Further Details:      
 
Domain Number 4 Region: 825-897
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000844
Family Rhamnogalacturonase B, RhgB, middle domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000008789   Gene: ENSSHAG00000007611   Transcript: ENSSHAT00000008862
Sequence length 1165
Comment pep:novel scaffold:DEVIL7.0:GL841494.1:335029:381291:1 gene:ENSSHAG00000007611 transcript:ENSSHAT00000008862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKLYTKHGTLKYQTDCAPNNGYFMIPLYDKGDFILKIEPPLGWSFEPTTVDLHVDGINDI
CTKGGDINFVFTGFSVNGKVLSKGQTLGPAGVQVMLKSIGNEAHIQSTVTQPGGKFAFFK
VLPGEYEIFASHPTWTLREASTTVRVTNSNAYAAGPLIVAGYNVSGSVRSDGEPMKGVKF
LLFSSSVAREDILGCNSSPVDGFQSQDEKLIFLCSVISKEDGSFSFFSLPSGRYTVVPFY
RGERITFDVAPSRLDFTVEHDSLKIEPVFHVMGFSVTGRVLNGPDGEGVSDAIVILNNQI
KVKTKGDGSFRLENITTGTYMIHAQKEHLYFDPITVKIAPNTPQLADIIATGFSVCGYIS
ITRFPDSIKQINKYKVVMTSQGREKSLITAETDSRGEFCFKAKSGNYKVQVVVPEAETRA
GLSLKPKMFPVVVNNRPVMDVTFSQFLASVSGKVSCLDTCGDLLVTLQSISRQGEKRSLQ
LSGKVNSMTFTFDNVLPGRYKISIMHEDWCWKNKSLEVEVTEEDASGIEFRQTGYMLRCS
LSHAITLEFYQDGNGPENVGIYNLSKGVNRFCLSKPGVYKVTPRSCHRFEHGYYTYDTSS
PSILTLTAIRHHVLGTITTDKLLDVTVTIKSSIDSEPALVLGPLKSVQELRREQQLAEIE
TRRQEREKNGKEEGGTTKPPVQEMVDDLQGPFLYDFSYWARSGEKITVTPSSKELLFYPP
SVETVVSGESCPGKLIEIYGKAGLFLEGQIHPELEGVEIIISEKGATSPLITVFTDDKGS
YSVGPLHSDLEYTVTSQKEGFVLTALEGTIGDFKAFALAGVTFEIKSEDDQPLAGVLLSL
SGGVFRSNLLTQDNGMLTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQNLKIAITGY
RTAYSCYGTISSLNGEPEQGVAVEAVGQGDCSIYGEDTATDEEGKFRLRGLLPGCIYHVQ
LKVEGNEHIERALPQHRVIEVGNSDIDDVNIIAFRQINQFDLSGNVITSSEYLPSLWVKL
YKSENLDNPIQTVSLGQSLFFHFPPLLRDGENYVVLLDSTLSKSQYDYTLPQVSFTAIGY
HKHITLIFNPTRKLPEQDIAQGSYIALPLTLLLLLAGYNHDKLIPLLLQLSSRLQGVRAL
GQTASDIGAPEEVKRQAKKQKTRRT
Download sequence
Identical sequences G3W034
ENSSHAP00000008789 ENSSHAP00000008789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]