SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009083 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009083
Domain Number 1 Region: 105-487
Classification Level Classification E-value
Superfamily L domain-like 2.38e-63
Family Internalin LRR domain 0.067
Further Details:      
 
Domain Number 2 Region: 696-791
Classification Level Classification E-value
Superfamily Immunoglobulin 1.21e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 609-705
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-20
Family I set domains 0.0074
Further Details:      
 
Domain Number 4 Region: 504-611
Classification Level Classification E-value
Superfamily Immunoglobulin 2.61e-17
Family I set domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009083   Gene: ENSSHAG00000007869   Transcript: ENSSHAT00000009159
Sequence length 1068
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856992.1:361884:392619:1 gene:ENSSHAG00000007869 transcript:ENSSHAT00000009159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASPQPSPWEPLVAMLVSGPLLRLLLLAQTALFLLPAAATAAARTGLCPAPCSCPLPLL
DCSWRKLLPALGWRALSGPLPPGATGLIMGHTKLSTYRRYCELRTKQEKKMNYNELTEIP
YFGESTSNITLLSLVHNVIPEVSAEQLQFYLSLETLDLSSNIISEIKTSSFPRMQLKYLN
LSNNRIATLEAGCFDNLSSSLVVVKLNRNRISMIPPKIFKLPHLQFLELKRNRIKTVESL
TFQGLDSLKSLKMQRNGISRLMDGAFFGLVNMEELELEHNNLIEVNKGWLYGLRTLQQLY
VSQNAIDRISPDAWEFCQQLSELDLSYNHLTRLDETAFAGLSLLEKLNLGDNRVTHIADG
VFKDLSNLRTLDLRNNEISWAIEDASEAFVGLNKLTKLILQGNHIKSVTKKAFIGLEALE
HLDLNNNAIMSIQENAFAQTHLKELMLNTSSLLCDCQLRWLLQWLVDNHLEQAVNVSCAH
PEWLAGQSILNVDPKDFVCDDFPKPQIRTHPETTIALKGVNVTLTCTAVSSSDSPMSTAW
RKDSEILYDADIENFARYRQQGGEALEYTTVLHLFNVNFTDEGKYQCIVTNHFGSNYSHK
ARLTVNELPSFLKTPMDLTIRTGAMARLECAAEGHPAPQISWQKDGGTDFPAARERRMHV
MPEDDVFFIANVKIEDMGIYSCMAQNIAGGLSANATLTVLETPSFIRPLEDRTVTRGETA
VLQCIAGGSPAPRLNWTKDDGPLMVTERHFFAAANQLLIIVDAGLEDAGKYTCIMSNTLG
TERGHIYLNVISSSNCDSAQSSVGHEDDGWTTVGIVIIVVVCCVVGTSLIWVIVIYHMRR
KSEDYSITNTEELNLPADIPSYLSSQGTLSEPQEGYSNSEAGSHQQLMPPGNGFMHKGPE
GGSSSRVICSDCYDNANIYSRTREYCPYTYITEEDGLDQTLSSLMVQMPQEACLAHPSPE
AVAVDTLTSSGDRDMSVYLTNHDRINEKALVSSTQMSNETSQRPLWGINKELGLPQSHFS
QQPVLESPRLLQKSDEDHSASPRPCHRLQGHSFDFSRTQNIQDGSEAT
Download sequence
Identical sequences G3W0X8
ENSSHAP00000009083 ENSSHAP00000009083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]