SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009169 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009169
Domain Number 1 Region: 429-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.28e-26
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 513-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.21e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 46-104
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.89e-25
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 5 Region: 682-738
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.95e-25
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 6 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.54e-25
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 7 Region: 625-682
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 8 Region: 569-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 9 Region: 723-775
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.43e-20
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 10 Region: 251-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000153
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 11 Region: 392-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000583
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 12 Region: 476-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000198
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009169   Gene: ENSSHAG00000007938   Transcript: ENSSHAT00000009247
Sequence length 783
Comment pep:novel scaffold:DEVIL7.0:GL849771.1:368756:383451:-1 gene:ENSSHAG00000007938 transcript:ENSSHAT00000009247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENLIQMLEKALPSQDSALSQGRNIEEEEEEEEEGMNSRLLTARSQSVTFRDVAVDFTQE
EWRRLAPAQRDLYRDVMLENYHNFASLGLPVFKPDVISQLERGEGPWTPEAEVPQVTCPE
SLVQRRFETMNSTSKQGASVGRSCKEKLTKTGPWDSKLGEPWEFDVRMEMQKNSSGDKEA
REITAIHRKTSNELSAQQCYTFVRRFSPESILVLQQKVPAGKVFHKYDTLEKSFRQLSDL
NKQNRVPLGKKLCKYNIGRKPFSYHSDLIQYHKIHTGEKPFECNECGKAFSQKGHLMDHQ
RIHTGEKPFVCTECGKAFSLRVCLTLHQRTHTGEKPYKCNECGKAFSQRGHRTEHQRIHT
GEKPYICNQCGKAFTNNSILRNHQRIHTGEKPYKCDECGKTFNQRRPLTEHQRIHTGEKP
FECTECGKAFSRKVYLTLHQRIHTGEKPYKCNECGKTFSQRGALKQHQRIHTGEKPFECT
ECGKVFSHRVCLTMHQRVHTGEKPFECNECGKAFSQHSNLTLHERIHTGEKPFECNECGK
TFSQFCHLIEHQRIHTGEKPFECNVCGKAFNHKWQLTEHQRIHTGEKPFECNECGKHFSH
RTSFINHQRIHTGEKPYECNECGKAFSNKSSLWNHNRIHTGEKPFECNECGKAFSQRGHL
TAHQKIHTGEKPFHCNECGKHFSHKTSFIHHQRIHTGEKPYECNECGKAFISNSNLRGHQ
RIHTGEKPFECNECGKAFRQSCHLTEHKRVHTGKKPFSCNECGKAFSTSSTLRKHLCKHL
CKL
Download sequence
Identical sequences G3W164
ENSSHAP00000009169 ENSSHAP00000009169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]