SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009181 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009181
Domain Number 1 Region: 364-486
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.8e-16
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 2 Region: 185-312
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000116
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 3 Region: 450-567
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000345
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 4 Region: 311-368
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000015
Family EGF-type module 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009181   Gene: ENSSHAG00000007948   Transcript: ENSSHAT00000009259
Sequence length 570
Comment pep:known_by_projection scaffold:DEVIL7.0:GL861544.1:369493:401975:1 gene:ENSSHAG00000007948 transcript:ENSSHAT00000009259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPLLCSSPWMFPSSRMLKASPAFPFPAVTADVLLEDCCTDGHRLATQKRDCSLPYASES
KECRMVQEQCCQNQLEELHCATGINVAHEGDSCDTHHDNSSFEAKFVKKCCRCCLLGKAA
QAQGQSCEYNLMIGYQCGLVYRACCVKGQETAELAPGDVAVAPDNSKLPEEEIVDQEDPY
LHDRCRGGGPCTQQCRDTGSAVVCSCFVGYQLLPDGVSCEDTNECITGLHNCRIGEICIN
TVGSFRCQRESSCGTGYELMEDNTCKDINECEIGIHNCLPNFICQNTPGSFRCRPKLQCR
SGFIQDALGNCIDINECLSINAPCPIGQTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCV
DVDECSPPAEPCGAGHLCINTPGSFRCDCKAGYYFDGISRTCADINECRRYPGRLCGHKC
ENTPGSYHCSCTVGFKLSSDGRSCEDLNECSSNPCSQECANVYGSYQCYCRRGYQLSDVD
GITCEDIDECALPTGGHICSYRCINVQGSFQCQCPSTGYKLAPNGRSCQDIDECAAGSHN
CSINSTCFNIQGSFRCLSFECPENYRKSGD
Download sequence
Identical sequences G3W176
ENSSHAP00000009181 ENSSHAP00000009181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]