SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009238 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009238
Domain Number 1 Region: 391-555
Classification Level Classification E-value
Superfamily PH domain-like 1.07e-58
Family Phosphotyrosine-binding domain (PTB) 0.0000000483
Further Details:      
 
Domain Number 2 Region: 569-692
Classification Level Classification E-value
Superfamily PDZ domain-like 1.08e-20
Family PDZ domain 0.0000304
Further Details:      
 
Domain Number 3 Region: 684-768
Classification Level Classification E-value
Superfamily PDZ domain-like 3.81e-16
Family PDZ domain 0.0000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009238   Gene: ENSSHAG00000007996   Transcript: ENSSHAT00000009318
Sequence length 775
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841515.1:373564:448877:1 gene:ENSSHAG00000007996 transcript:ENSSHAT00000009318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHVEGPPDVEVTDEPGSGESGEVNESVEADLEHPEAEEEQRLQPQHATPYPGDPVQGTR
GPQPVQGLEEEDRGSSLARSASTESGFHNHTDTAEGDIIAASAEDGYDPERAQENEDESA
YAVQYRPEAEEYTENAEAEHAEASHRRXLRLYQREREEVDSYRKEALGARLHHYDERSDG
ESDSPEKEAEFAPYPRMDSYEQEEDIDQIVAEVKQSMSSQSLDKAAEDMPEAEQNLDGAP
SPEDGCGNADELGSPGQPAPVGPGPAVLTGEVGQRYSKEKRDAISLAIKDIKEAIEEVKT
RTVRSPYTPDEPKEPIWVMRQDISPTRDCDDQRPADGDSPSPDSSSPRGAESSGRQHQQD
DLAESSGNKESRKSLASFPTYVEVPGPCDPEDLIDGIIFAANYLGSTQLLSDKTPSKNVR
MMQAQEAVSRIKMAQKLAKSRKKAPEGESQPMTEVDLFISTQRIKVLNADTQETMMDHPL
RTISYIADIGNIVVLMARRRMPRSNSQDNVEASHPSQDGKRQYKMICHVFESEDAQLIAQ
SIGQAFSVAYQEFLRANGINPEDLSQKEYSDLLNTQDMYNDDLIHFSKSENCKDVFIEKQ
KGEILGVVIVESGWGSILPTVILANMMHGGPAEKSGKLNIGDQIMSINGTSLVGLPLSTC
QSIIKGLKNQSRVKLNIVRCPPVTTVLIRRPDLRYQLGFSVQNGIICSLMRGGIAERGGV
RVGHRIIEINGQSVVATPHEKIVHILSNAVGEIHMKTMPAAMYRLLTAQEQPVYI
Download sequence
Identical sequences G3W1D3
ENSSHAP00000009238 ENSSHAP00000009238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]