SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009239 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009239
Domain Number 1 Region: 3-97
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.02e-28
Family PWWP domain 0.0000193
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009239   Gene: ENSSHAG00000007997   Transcript: ENSSHAT00000009319
Sequence length 336
Comment pep:novel scaffold:DEVIL7.0:GL867595.1:373823:374833:1 gene:ENSSHAG00000007997 transcript:ENSSHAT00000009319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTYNFKPGDLIFAKMKGYPHWPARIDEVPDDVVKPPHNKLLIFFFGTHETAFLAPKDIFP
YSENKAKYGKPNKRRGFNEGLWEIDHNPRVKPFKKRPVAYTEMEGGKKEGTTSKGDSEGK
PRYGGGPPKSAAAASASSSAASSTAGAPRGRKRKAEKAVEAEETEGAKATTSTTTMTPQV
SPKKGKPWPPPSPTPAAVRMNNPKGKAKMYKLTNPGEGEGASEEDKGKKKGQEEKPPKKQ
MRKEEESEKEEDKPKKDPGKKEMKKEVDPKRKLVKPTMASGVIPSDSEEEGEEQEGERKR
RLSRNFEVVHRKGALKGQFEKEEEAEAEPQTACNLQ
Download sequence
Identical sequences G3W1D4
ENSSHAP00000009239 ENSSHAP00000009239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]