SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009256 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009256
Domain Number 1 Region: 514-694
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.3e-38
Family Laminin G-like module 0.001
Further Details:      
 
Domain Number 2 Region: 71-267
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.03e-35
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 293-397,429-510
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.72e-24
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 4 Region: 2-66
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000208
Family Laminin G-like module 0.028
Further Details:      
 
Domain Number 5 Region: 720-755
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000299
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009256   Gene: ENSSHAG00000008013   Transcript: ENSSHAT00000009336
Sequence length 756
Comment pep:novel scaffold:DEVIL7.0:GL864914.1:375576:411581:1 gene:ENSSHAG00000008013 transcript:ENSSHAT00000009336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGQVTISVDGILTTTGYTQEDYTMLGSDDFFYIGGSPNTADLPGSPVSNNFMGCLKDVVY
KNNDFKLELSRLAREGDPKMKLQGDLSFRCEDVAALDPVTFESPEAFVALPRWSAKRTGS
VSLDFRTTEPNGLLLFSQGRRAGGGQGGHGAARADYFAMELLDGYLYLLLDMGSGGIKLR
ASNRKVNDGEWCHVDFQRDGRKGSISVNSRSTPFLASGESEILDLESELYLGGLPEGGRT
DLPLPPEVWTAALRAGYVGCVRDLFIDGPAHPVLLFPRQMPSHPIAASCPSKCRPPPSGS
SAFCNLSFSLSLVSVSFSASISVSLFLPPSLLSPSLSLYMKIMLPTAMHTEAEDVSLRFM
SQRAYGLMMATTSKESADTLRLELDGGQMKLTVNLVCMSVCVIVYDCVSVIVCMSHPPTH
PPLGAAGKGPETLFAGHKLNDNEWHTVRVVRRGKSLQLSVDNVTVEAGQMAGAHTRLEFH
NIETGIMTERRFISVVPSNFIGHLSGLLFNGQPYMDQCKDGDITYCELNARFGLRAIVAD
PVTFKSRASYLALATLQAYASMHLFFQFKTTAPDGLLLFNSGNGNDFIVIELVKGYIHYV
FDLGNGPSLMKGNSDKPVNDNQWHNVVVSRDPGNVHTLKIDSRTVTQHSNGARNLDLKGE
LYIGGLSKNMFNNLPKLVASRDGFQGCLASVDLNGRLPDLIADALHRIGQVERGCDGPST
TCTKDSCANQGVCLQQWDGFTCDCTMTSYGGPICND
Download sequence
Identical sequences G3W1F1
ENSSHAP00000009256 ENSSHAP00000009256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]