SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009316 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009316
Domain Number 1 Region: 239-367
Classification Level Classification E-value
Superfamily PH domain-like 5.75e-33
Family Pleckstrin-homology domain (PH domain) 0.00029
Further Details:      
 
Domain Number 2 Region: 414-510
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-24
Family SH2 domain 0.0000345
Further Details:      
 
Domain Number 3 Region: 15-75
Classification Level Classification E-value
Superfamily Phenylalanine zipper 6.28e-20
Family Adapter protein APS, dimerisation domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009316   Gene: ENSSHAG00000008060   Transcript: ENSSHAT00000009397
Sequence length 629
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841441.1:379198:455871:-1 gene:ENSSHAG00000008060 transcript:ENSSHAT00000009397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGPALQPSPSSNPRGWSEFCELHAVATAKELAKQYWLFASEHPHHDLLGADHFSLQFTD
LFQQYFRHEVREGWAMHQLRLRPFTSRVRDYRETGRRHTDGSAAPPKAEAPVDAGERASE
VAAQPLPKARSSEELTGGASPLASPRSIAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXHHLRRSLRHIFRRRPSETLTPGEGTAEGEPGDPPSKQGLAKKIL
PWSLSREPAPEARKEGVLKYGLVDEATMDSGALRQRGRLVLRKAASPEGGEDYVLELFDP
PKGSKPKFQAVCSSIHEIRRCTRLEMPDNLNTFVLKVNNLTDIIFETGDEQQLNSWTTEI
RECMSRGLEGADSESHFPSLPDPGITSNSPSGSTDSLTQGASPGGLLDQACQKTEHFLSC
YPWFHGPISRVKAAQLVQLQGPAGHGVFLVRQSETRRGEYVLTFNFQGRAKHLRLSLTER
GHCRVQHLHFPSIVDMLHHFQRSPIPLECGAACDVKLSSYVVVVSQAPGSTSTALFPFSV
HRWSSDLGLPHLTASSCPHTLLPEDLPPSRSSPSEQIFHLLPPPEELANSLRHMDQSADP
AGQARDSDYEIDSPSRGHLRAIDNQYTPL
Download sequence
Identical sequences G3W1L1
ENSSHAP00000009316 ENSSHAP00000009316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]