SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009331 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009331
Domain Number 1 Region: 79-127
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000301
Family TSP-1 type 1 repeat 0.0068
Further Details:      
 
Domain Number 2 Region: 51-82
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000183
Family Somatomedin B domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009331   Gene: ENSSHAG00000008072   Transcript: ENSSHAT00000009412
Sequence length 266
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834670.1:381288:411218:-1 gene:ENSSHAG00000008072 transcript:ENSSHAT00000009412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHSAVLAWVWALALGVVPGVQAGCADLGRCCQGRDLTCVSRGWTAAGPSLEPQPCYCDQ
ACSGAGDCCPDYGSACPAVTCAVSEWSGWSRCIEPCTVTFRVRRREVLREPRNGGGPCPA
LEERAGCVEYWSDQGVECKQALIPALITTGAFRTWRKKRAVALERKSAGYCVMFELVTIT
MGCFQTRAPYTQWMRYLSQGHTLCVLCEPPALDMRSLRCYGDGEGSRGDQLLQWQAVGNP
SCRGTWKRFQQLEACSCPDVHSFLFV
Download sequence
Identical sequences G3W1M6
ENSSHAP00000009331 ENSSHAP00000009331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]