SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009745 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009745
Domain Number 1 Region: 179-389
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-32
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 2 Region: 624-828
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.95e-27
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 3 Region: 402-604
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.48e-24
Family Laminin G-like module 0.02
Further Details:      
 
Domain Number 4 Region: 854-897
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000102
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 5 Region: 1012-1053
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000286
Family EGF-type module 0.005
Further Details:      
 
Domain Number 6 Region: 21-66
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000867
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 916-1049
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000628
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 8 Region: 56-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000251
Family EGF-type module 0.011
Further Details:      
 
Domain Number 9 Region: 114-143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000614
Family EGF-type module 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009745   Gene: ENSSHAG00000008433   Transcript: ENSSHAT00000009830
Sequence length 1121
Comment pep:novel scaffold:DEVIL7.0:GL856772.1:421640:537712:1 gene:ENSSHAG00000008433 transcript:ENSSHAT00000009830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YRCDCAGSGFTGKHCETLLPVCWSQPCHHNGTCEELDDTYICHCWPGFTGSHCEIDINEC
SSNPCLSTGECVERSWANQYGRISELPSEFNYLHATGYVCHCQPGYTGIRCEDDIDECSS
DPCKNGGTCENFPGNYTCHCPAQDYQGIIYGGVDCREIFLGCIRNKCQNDGICIPYIQNG
QHESSCLCPPGYSGSLCDIVTTFSFEGNSFLWMTSGSGITPFHIALSFQTVQSSALLLLR
GDKDTYVKLELWNGYVYLSVQVNNQSKVLLHISHNTSDGEWHSVEVTLAEAVTLTLRDNS
CVEKCVDKAPSPIDSDQVMIAFQNTFLGGLPVGKTNDGAALLNIYNLHSAPSFVGCLQDI
EIDSNLITPENISSGSSFNVKAGCNKKDWCENHPCQNRGRCINLWLSYQCDCYRPYEGVN
CLREYTAGRFGQDDSTGYALFRLDNNQEQIVTLSMFVRTRKSYSFLLALKNSTFQYINVW
LEHGRLAVLTPSSSRLLGRSLLNDGNIHLITLKMEPKKIELYQSSQNLGYLSTPTWKIRS
GDVLYVGGLPDKKETEVWGGYFKGCIQDIRLNSHKLELFPISKGNSTLNQTLVNVTPGCP
GDNLCKYNPCHNGGVCYSIWDDFTCSCPPNTAGKACEEVKWCELSPCPPESQCQLVSKGF
DCSIANAVFHGQESTIFFRSNGKITRELTNITFGFRTRNSNIILLYAEKEPEFITISIQN
SRLVFQLQSGNSFYMLSLRSMQPVSDGMWHQVFLSMIEPFAQSSRWRMEVDDQTTIVTSL
VATGNLNFLREETNIYLGDKPFDNLDGLQGCLSSVEISGIYLSYFENAVVHTKKPQEEQF
LRISTNPVIVGCSQVDACSSNPCLHNGECEDFYNSYGCVCRKGWTGTHCEINVDECFSRP
CIYGNCSDRIAGYICRCNSGYTGVNCETNIDDCENHQCANGATCIDGISNYSCQCLSNYT
GKFCRQTRLPMTVCGNERRNLTCYNHSNCTELQGDLKCVCRPGFTGQWCEKDINECDSDP
CLNGGLCRNLLNTFQCNCDGNFAGERCELDLTDNLISDIFTAIGSITLAVLLILFLAVVA
SFIASNKRANQGTYSPSRQEKEGSRVEMWNMVQPPPMERLI
Download sequence
Identical sequences G3W2U0
ENSSHAP00000009745 ENSSHAP00000009745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]