SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009767 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009767
Domain Number 1 Region: 2609-2753
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-19
Family Laminin G-like module 0.0052
Further Details:      
 
Domain Number 2 Region: 2398-2594
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000121
Family Laminin G-like module 0.018
Further Details:      
 
Domain Number 3 Region: 1360-1411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000067
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 4 Region: 534-579
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000012
Family Laminin-type module 0.0046
Further Details:      
 
Domain Number 5 Region: 1692-1734
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000544
Family Laminin-type module 0.0061
Further Details:      
 
Domain Number 6 Region: 1744-1794
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000642
Family Laminin-type module 0.046
Further Details:      
 
Domain Number 7 Region: 1270-1318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000103
Family Laminin-type module 0.0077
Further Details:      
 
Domain Number 8 Region: 295-354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000921
Family Laminin-type module 0.069
Further Details:      
 
Domain Number 9 Region: 489-536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000165
Family Laminin-type module 0.0073
Further Details:      
 
Domain Number 10 Region: 352-424
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 11 Region: 1409-1457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 12 Region: 629-679
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000131
Family Laminin-type module 0.006
Further Details:      
 
Domain Number 13 Region: 682-723
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000023
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 14 Region: 422-465
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000614
Family Laminin-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009767   Gene: ENSSHAG00000008451   Transcript: ENSSHAT00000009852
Sequence length 2830
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841303.1:424112:696849:-1 gene:ENSSHAG00000008451 transcript:ENSSHAT00000009852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGVQKGTPTAAPTPRRFPRLFLLLLFPLSGAAASPEPQTGFSLHPPYFNLAEAARISAT
ATCGEDPGSARPRPELYCKLVGGPIASTTGHTIQGQFCDYCNSGDPNKAHPVTNAIDGTE
RWWQSPPLSLGLQYNKVNVTLDLGQLFHVAYVLIKFANSPRPDLWVLERSVDSGRTYLPW
QFFAHSKIDCWEQFGTDANMPITKDNDVICTTEYSRIVPLENGEVVVSLVNGRPGAKNFT
FSPTLREFTKATNIRLRFLRTNTLLGHLISKAQRDPTVTRRYYYSIKDISIGGRCVCNGH
AEVCRAKGPENLFQCECQHNTCGESCDHCCAGYNQKQWRPATAERTNECEVCNCHGHATD
CYYDPDVERQSESLNIHGVYEGGGVCINCQHNTAGVNCEKCIQGYYRPYNVPVEAPHGCM
PCSCNPENTNGCEEGTGRCFCKSNFQGENCERCAEGFYNFPFCQRKFGLFAGETTFSDLE
SILKFTKRCECNPVGVVSEICDFQGKCLCRFGVDGPKCDSCSSGFYSFPACQACQCSPLG
SYQTTCDPVTGQCECRPGITGQQCDQCLSGAYDFPHCQGFSSECNPAGTIDSSSGYCQCQ
LYVKGPTCSICKPLYWNLADENPDGCSECQCDVTGTLSGVGECEQKEGECYCKPHVCGDS
CNTCEDGYFALGDSNYFGCQGCHCDIGGSVSFMCDDLSGACQCREHIMGQSCQQPEDNYY
FPDLHHIKFEIEDGMTPNGRGVRFGFNPLEFPDFSWRGYAQMTPVQNEVRVTLNVEKSNQ
YLFRAVLRYINPGTETVFGHINIYRPHSKAGAIQSKEIVFLPSKEPAFVTVPGNGFADPF
SLTPGTWTVSIKAEGILLDYLVLLPSDYYEASILQLPVTEPCAYSGPIEENCLLYQHLPV
TRFACALACEAERFLLNGMPQVLATRKPTPELPIMADISGREIELHLTLSIPQVDHYVIV
LEYTNEDDQLYVADVLVNTPSPSPAGRVNIYSCKYSFLCRSFVVDDLNRVAVYELLADAR
IQLKAHFAHFLLHQICIIPVGEFSTEYVKPSIHCIASYGQFVNQSSSCVLLAHETPPRAL
VLDALSGGMSPVVPPDPSPLESVFQGIVLKSPQNQVTLNGRVPHLGQYVFIVHFCQPDHP
SFPAQVVVEGGHLWSVHTGSFSAYFCPQVFGCRNLVIAESQTNLDLSEPEFSVTIKVPDG
KSLMLGHVLVVPAENYGYHMLHKKTVDKSFDFINNCGGNSFYIDPLTSSKFCKDSARSLA
AFYNNGALPCDCHGVGAVSPTCDPEGGQCQCRPNVIGRQCTRCQTGYYGFPFCKLCHCGQ
RLCDEMTGKCICPPRTVKPQCEVCEKQSFSYHPLVGCKGCNCSRIGAISAPAPECDRNSG
QCRCKPRITGRQCDRCASGFYHFPECLPCNCNQDGTESGVCDPWTGACLCKENVEGAECN
VCRKGSFYLDPTNPKGCTSCFCFGISDHCHSTNKRRAKFVDMMGWRLETTDQMDIPVTFN
PGSNSVVADVQELPSSVHSVFWIAPSSYLGDKVSSYGGFLTYQVKSFGLPSEGMMLLEKR
PDVQLSGQQMTIVYMDPNNPLPDRRYYGRVQLVEGNFRHVSSNNQVSRGELMMVLSRLDG
LHIRGLYFTETQRLTLGEVGLEEVTSTGSGSIAYNVEICSCPPDYTGDSCQGCSPGYYRD
NKGFYTGRCVPCNCNGHSNRCQDGSGICINCQHNTAGANCERCKEGYYGDALQGSCQVCP
CPHTNSFATGCVVNGGNVKCSCKPGYVGVQCERCAPGYFGNPQKFGGSCQPCNCNNNGQL
INCDPLTGDCINQEPKDGGPEECDDCDSCVMTLLKDLEKMNDELRLVKSQLQSTTASAAT
LEQMKRLETQTKDLRNHLLNYQSAISSHGSKVDALEKNLNSLNQDFETLHEKVQINSRKA
QTLYNTVAQTNQNAKQLDTRIQNVIRDVHVLLKQISGTDGDGNTLPSGDFSRKLAEANRM
MREMRNRDFREQLRKAEAEKIEAQVLLNRIQSTLKIHQAENNDLVKSVRDSLNEYEAKIN
DLRKALQEATLQTKLANGLNQANDRSLEDVKRRIKEMSSLQSEFNKYLTTAESSLSQTNS
VLQLMKKSQEKKQDYEKLASSLNEVRQELSDKVKDLSRSSSKESLVVEAENHAQSLQKLA
KQLEEIKRNTSGDELVRCAVDAATAYENIINAVKAAEDAANKAVSASDSALQTVVKGDLP
GKAKILSSNSDKLLREAKTTQTKLQQDIRPALDSLRDTLDIVTTKKGLIQTDLTTVQDDL
RGINRDDIDSITSNAKSLIRNANDITSGVLDGLNPIHTDVERIKDTYGSTRSEDFNEALS
DANNSAIVKKLTSKIPDLLSKIQSINQQLLPLGNISDNVDRIRELIQQARDAANKVAIPM
RFNGKSGVEVRLPNDLEDLKGYTSLSLFLQRPDSREYGGDEEDMFVMYLGNKDASKDYIG
MAVRDGKLVCVYNLGDQEAEIQMDSILTKSITQEAIMDRVKLQRIFQFAKLTYFKEATSH
KPKPPDFYDMDSGSGDILLNLDPENVVFYVGGYPSNFKLPRELNYPPYKGCIELDDLNEN
VLSLYNFKKTFNLNTTEVEPCRRKKEESDKNYFEGTGYARVPTQSNTPFPTFLQTIQTTV
DEGLLFFAEHQDFFISLSMEKGYPVLRYKLNSELPKEKRSRILINDGADQMITIRMGKMQ
NILRVTVNQTLIEVPGKIFNFNTYYLGGIPISLRDKFNISTPAFRGCMKNLKKTIGVVRL
NDTVGVTKKCSEDWKLVRTASFSREGQISFINVGLPDPNNFQSSFGFQTFQPHGILLRHQ
IGVRKMIFTL
Download sequence
Identical sequences G3W2W2
ENSSHAP00000009767 ENSSHAP00000009767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]