SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009772 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009772
Domain Number 1 Region: 1553-1804
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-55
Family Ankyrin repeat 0.0000000601
Further Details:      
 
Domain Number 2 Region: 790-917
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000518
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number 3 Region: 494-614
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000022
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 4 Region: 388-511
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000235
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 5 Region: 267-429
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000251
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 6 Region: 121-163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000733
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 7 Region: 233-275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000274
Family EGF-type module 0.014
Further Details:      
 
Domain Number 8 Region: 913-952
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000393
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 9 Region: 1130-1167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000714
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 10 Region: 975-1017
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000911
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 158-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000947
Family EGF-type module 0.0032
Further Details:      
 
Domain Number 12 Region: 1049-1093
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family EGF-type module 0.012
Further Details:      
 
Domain Number 13 Region: 732-768
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000447
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 14 Region: 657-694
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000607
Family EGF-type module 0.01
Further Details:      
 
Domain Number 15 Region: 1248-1281
Classification Level Classification E-value
Superfamily Notch domain 0.000000115
Family Notch domain 0.0034
Further Details:      
 
Domain Number 16 Region: 199-240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000255
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 17 Region: 81-120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000447
Family EGF-type module 0.007
Further Details:      
 
Domain Number 18 Region: 1209-1241
Classification Level Classification E-value
Superfamily Notch domain 0.000000615
Family Notch domain 0.0048
Further Details:      
 
Domain Number 19 Region: 622-659
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000695
Family EGF-type module 0.01
Further Details:      
 
Domain Number 20 Region: 691-734
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000251
Family EGF-type module 0.011
Further Details:      
 
Domain Number 21 Region: 1091-1127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000102
Family EGF-type module 0.021
Further Details:      
 
Domain Number 22 Region: 43-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000028
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009772   Gene: ENSSHAG00000008456   Transcript: ENSSHAT00000009857
Sequence length 2105
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841437.1:424381:456510:-1 gene:ENSSHAG00000008456 transcript:ENSSHAT00000009857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XGPGAGGRGSAGLRGNPPPTPPFLGCSPSLQLLAQGGRRAPQCLDGGNPCENGGRCTLLS
NGEAACLCHPGLMGDRCQFEDPCHHAPCTNGGTCKSSLLQGTVQYSCVCPRGFRGQDCSF
IDPCATNPCANGGRCFSNHNRYNCTCPAGYQGRTCRSDVDECRVGTVCQHGGTCINVPGS
FRCQCPVGYAGPLCESPSAPCAPSQCRNGGTCHQTGEFTYDCACLPGFEGHDCEVNVDDC
PRHRCMNGATCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTHGGHSC
VCVNGWTGESCSENIDDCASAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNPC
HEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHFGKCVNTQGSFQCQCG
RGYTGPRCETDINECLSGPCHNQATCLDRIGQFTCICMAGFTGTFCEVDIDECQSSPCVN
GGQCRDRVNGFSCTCPSGFSGTMCQLDVDECASTPCHNGAKCVDQPDGYECRCAEGFEGP
LCENNVDDCSPDPCHHGSCVDGIASFSCTCAPGYTGSRCESQLDECYSQPCQHGAKCLDL
VNKYLCYCPPGTSGGPPQTEGCWCASNPCDYGVCQDGINRYDCICQPGFTGPLCNVEINE
CSSNPCGEGGSCVDEENGFHCLCAPGFLPPLCHAQRHPCASNPCSHGTCHDDPSGHRCEC
EPGWTGPTCDQNQNECESNPCQAGGTCTDYINGFRCTCPAGLQALSCLLASHPLVHSRSL
LASLPLCVFCPPGPYCEQDIDECEGARPCGPHGFCINFHGGFSCTCDPGYSGNTCERDID
DCDPNPCLNGGSCRDGVGSFSCTCLPGFTGPRCALDIDECQSSPCGPGTCSDHVASFTCA
CPAGYGGLRCERDLPNCSESSCFNGGTCVDGLNAFTCLCRPGFTGPHCQREVGAXGVLCE
INEDDCAASLRGEQGPQCLHNGTCVDQVGGYRCTCPPGYTGAHCEGDLNECSPGACHAAH
TRDCLQDAYGGFRCLCRPGYTGRRCQTAVSPCESQPCQHGGQCQPSPNSPLAYTCHCPPP
FWGSSCERVARSCRDLPCANGGLCQLTALGPRCTCPPGLAGPSCHLRTNTSCLGSPCRHG
GTCRALTQAPFFRCLCPPGWEGPHCEGRVRGALPPLLSPPEEPQCPRASCRDCQWDGGDC
SLSVDDPWHQCQALQCWRLFNNSHCDPACNTPACLYDNFDCHSQERGCNPVYEKYCSDHF
ADGRCDQGCNTEECGWDGLDCAGAVPELLAKGVLVLTVLLPPEELLRSSADFLQRLSAIL
RTALRFRRDAHGNLMIYPYHRPGGRPSRELAPEIIGSVVMLEIDNRLCLQTPESNHCFPD
AQSAADYLGALSAVERLDFPYPLRAVRGEPLQPPEPSLRLLPLLVVGAVILVTLGLGVLV
ARRKREHSTLWFPEGFSLNKESSGANKGRREPVGQDALGMKNMTKGESLMGEPSEDWMDT
ECPEAKRLKVEEPGSGAEDPVDCRQWTQHHLVAADIRVPPAMALTPPQGDLDADGMDVNV
RGPDGFTPLMLASFCGGALEPVLVDTEEAEDTPANIISDLICQGAQLGAQTDRTGETALH
LAARYARADAAKRLLDAGADTNAQDHTGRTPLHTAVTADAQGVFQILIRNRSTDLDARMA
DGSTALILAARLAVEGMVEELIACHADVNAVDELGKSALHWAAAVNNVEATVALLKNGAN
KDMQDSKEETPLFLAAREGSYEAAKVLLDHFANREITDHLDRLPRDVAHERLHQDIVRLL
EEHNTARSPPGAHGLAPLLCPPGTFLPGLKPTPSGSGSKKSRRPPGKGGPGASGPKGRTK
KLTLACPGPLLESSVTLSPVDSLDSPRPFGGTPASPGSYPLDGPYAATVSLAQLGGTGRA
ALGRPPGGCVVNLGLVSPVAVPFDWARLPPPAPGTTHPSLAPPGPSFLLPGPLPLAPGPQ
ILVPGTSVPPKEPPPQYLPPGGTAEEYPPPTGPVPPARGSPSKHFLRVPSEHPYLTPSPE
SPELWASPSPRSLSDWSDSTPSPATGALLTPHPGPGPLAQGQGQGQTQTQLGPRPDPTPK
RQVLA
Download sequence
Identical sequences G3W2W7
ENSSHAP00000009772 ENSSHAP00000009772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]