SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009884 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009884
Domain Number 1 Region: 946-1003
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.26e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 610-667
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 3 Region: 203-260
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-22
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 4 Region: 722-779
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-22
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 5 Region: 834-891
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-22
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 6 Region: 890-947
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.16e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 7 Region: 1058-1115
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.98e-21
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 8 Region: 442-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-21
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 9 Region: 555-611
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.38e-21
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 10 Region: 666-723
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.37e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 11 Region: 498-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.37e-21
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 12 Region: 1002-1059
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-20
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 13 Region: 778-835
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-19
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 14 Region: 1100-1152
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.42e-18
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 15 Region: 405-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000677
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009884   Gene: ENSSHAG00000008558   Transcript: ENSSHAT00000009971
Sequence length 1161
Comment pep:novel scaffold:DEVIL7.0:GL841448.1:436175:454247:1 gene:ENSSHAG00000008558 transcript:ENSSHAT00000009971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METETSGIRREEPSRDWWRERGAAGTGGTKDSLLTCHFRTFTGSPVVQGARSETPQLLSQ
FGLLLRRRRRRRWRGPSSVPPRRRGRGRDREELGACFRRFQGKGRVERRRGWSGSESRAC
AVPFSPKHPTRLPVAPLRRDQLCYSISSVWALINLFKRDAFWDKFINSFLKITTSAVLPS
DNLILNQKHSMAPVLLTAGTHPESVTFKDIVVEFTRTEWQYLTSSQKELYRDVMLENYGN
LVYLGLAVSKPDVISQLEQREAPWMPGGAQKSNCPDWEATPTTKQSLQNLGISVKYLWQE
KGTRKNLCFSTLKKAWDCDAILGRHQSNLEKHSQKEKITENKPTNKSRSHKYNKCCRSIT
QGQVFLPKQILSLKTNFCKREAQRKGMIQSKELVKCKKTYSKKKFSKYNEYGKCFKYNSY
LAENRRLHNGEKHYQCNECDKAFSKRVSLTQHHRIHTGEKPYECDVCRKTFRQSTGLTQH
QTIHTGEKYYECNECKKAFRMRSQLIQHYRIHTGGKPYECTECGKTFRLRIELNQHHNIH
TGEKPYRGNECGKVFGFKSQFIQHQTMHSGEKPYECNQCGKAFRQSTGLTQHQTIHTGEK
CYKCGECEKTFRLRTQLIQHYRIHTKEKPYECNECGKAFRQNSQLIQHQTIHTGDKPYEC
NECGKAFRLRIELTQHCNIHTGKKPFKCNECGKVFHLSSQLICHQTIHSGEKPYECNECG
KTFRQSTGLNQHQTIHTGEKHYECNECKKAFRLRSQLIQHYRIHSGEKPYECGECGKAFR
QNSQLTQHHTVHTEEKPYECNECGKSFRLRIELTQHHKIHTGKKSCRCNECGKAFRLNSQ
LIQHQIIHSGEKPYECNECGKTFHKSACLTQHQKIHTGEKHFKCNECGKTFVQRAVLTQH
QRIHTGEKPYECNECGKAFRQSTGLAQHQAVHTGRKQYKCNECESAFSQRADLIRHHRIH
TGEKPYECNECGKAFRLSTQLTRHQKIHTGKKPYECNECGKAFRLKTRLNEHQTVHTGEK
RFECGECGKAFRQKTHLTEHLSVHSGEKPFECTDCGKAFRLRTQLTQHHIIHTGEKPYEC
NVCGKAFSQRTERNRHHRIHTGEKRYECNECGRAFRLSTHLTRHKRIHTGEKPYECGECE
LAFRLRAQLTHHQRIHRRENS
Download sequence
Identical sequences G3W379
ENSSHAP00000009884 ENSSHAP00000009884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]