SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000010170 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000010170
Domain Number 1 Region: 253-545
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 3.34e-87
Family Complement components 0.0000253
Further Details:      
 
Domain Number 2 Region: 626-747
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.06e-30
Family Alpha-macroglobulin receptor domain 0.0018
Further Details:      
 
Domain Number 3 Region: 89-141
Classification Level Classification E-value
Superfamily E set domains 0.0000000672
Family SVA-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000010170   Gene: ENSSHAG00000008788   Transcript: ENSSHAT00000010259
Sequence length 794
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856908.1:464734:512616:1 gene:ENSSHAG00000008788 transcript:ENSSHAT00000010259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNAEDQVMLTSGTIDMDSALEGAFAGSTNPSIRKHFPETWLWMDINMGSQTDKEFEVIV
PDSITSWVATAFVISEDLGLGMTTVPVELQAFQPFFIFLNLPYSIIRGEQFVLEVTIFNY
LKDASEVIVTIETSDKFDILMISNEVNATGHQQSILVPSEDGRTVLFPIKPKHLGEIPIT
VTAVSPSASDAITQNILVKAEGIETSYSQSLLLDLTGNKLSTTNHTLNFTFPPDRVIGSE
KIHITAVGDILGPSINGLESLIRMPYGCGEQNMINFAPNIYVLNYLTNTRQLTNNVKDKA
IQFMRQGYQRELLYQRDDGSFSAFGNNDPSGSTWLSAFVLRCFLQASPYIDIDQDVLHRT
FSWLKKHRKPNGEFWEPGKVIHSDLQGGNNSPITLTAYILTSLLGYQKYQASMDMRASVN
FLESQFREGVSDNYTLALISYALSSVDSSEGRAALDMLNQRAEHEGGMQFWESSVSKLSK
SWQPSSLDIEVAAYALLSHFLQNRMAEGMPIMRWLSKQRNRLGGYSSTQDTIVALHALST
FAALTTTGQTDMRVTVTGPSVTIPREFPINTKNRFLLQTAELAVQQPTSVTVSASGFGFA
FCQLNVVYNVKNSESSRRRRSIESQEAFDLDVAVKDNKEDINHLTVNVCTRFRGPSKSGM
ALMEVNLLSGFAMPPDAILLSDTIKKVENDHGQVNLYLDSVNETQFCVDIPAVRHFKVSN
TQDASVSIVDYYEPRRQAVRSYNSKVMLDVSSCDLSDGEQNWEFCKDSSPRLFQNSVVVS
FWCFLFLSSLQIWL
Download sequence
Identical sequences G3W415
ENSSHAP00000010170 ENSSHAP00000010170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]