SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000010305 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000010305
Domain Number 1 Region: 60-100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000474
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 2 Region: 10-39
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000502
Family Laminin-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000010305   Gene: ENSSHAG00000008898   Transcript: ENSSHAT00000010395
Sequence length 126
Comment pep:novel scaffold:DEVIL7.0:GL856860.1:478274:506197:1 gene:ENSSHAG00000008898 transcript:ENSSHAT00000010395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMNKLITHRKACKGGKGGFPPTAC
DCHPVGAAGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKTSILGIFISTG
VKLYEY
Download sequence
Identical sequences G3W4F0
ENSSHAP00000010305 ENSSHAP00000010305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]