SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000011005 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000011005
Domain Number 1 Region: 1-51
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000146
Family PDZ domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000011005   Gene: ENSSHAG00000009484   Transcript: ENSSHAT00000011099
Sequence length 51
Comment pep:novel scaffold:DEVIL7.0:GL867621.1:549390:549545:1 gene:ENSSHAG00000009484 transcript:ENSSHAT00000011099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IEDGGKAALSRKMRIGDELVNINGTPLYGSRQEALILIKGSFRILKMIVRR
Download sequence
Identical sequences G3W6F0
ENSSHAP00000011005 ENSSHAP00000011005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]