SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000011068 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000011068
Domain Number 1 Region: 533-748
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.27e-104
Family Thrombospondin C-terminal domain 0.0000000934
Further Details:      
 
Domain Number 2 Region: 406-531
Classification Level Classification E-value
Superfamily TSP type-3 repeat 5.23e-33
Family TSP type-3 repeat 0.00000332
Further Details:      
 
Domain Number 3 Region: 28-73
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 6.41e-17
Family Assembly domain of cartilage oligomeric matrix protein 0.00018
Further Details:      
 
Domain Number 4 Region: 263-324
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000432
Family TSP type-3 repeat 0.0021
Further Details:      
 
Domain Number 5 Region: 173-216
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000503
Family EGF-type module 0.016
Further Details:      
 
Domain Number 6 Region: 90-145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000268
Family EGF-type module 0.029
Further Details:      
 
Domain Number 7 Region: 377-408
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000432
Family TSP type-3 repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000011068   Gene: ENSSHAG00000009531   Transcript: ENSSHAT00000011162
Sequence length 761
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841420.1:555435:567943:-1 gene:ENSSHAG00000009531 transcript:ENSSHAT00000011162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLSPSRGLLLAFVCHLVSGQRQAPVGGDVAPQMLREMKETNLVLQEVRELLKQQIKEIT
FLKNTVMECDACGMQPVSSPWTSVRPQRSCEPDSCFPGVTCTETPGGGFRCGPCPPGYSG
NGYHCTDVNECNAHPCYPRVRCINTSPGFRCEACPPGYSGPAHEGVGLAFAKANKQVCTD
INECETGQHNCVPNSMCTNTRGSFQCGPCKPGFVGDQASGCRRKTQRMCPNGEPSPCHEN
ADCILERDGSTSCVCAVGWAGNGLVCGKDTDLDGFPDEKLRCPDRKCRKDNCLKVPNSGQ
EDVDKDGIGDACDPDADGDGILNEQVRRGVGRGEGKRRGDREGRGAAATHCSISSSPPPT
QTHKNDRTLSRKESVNKLRIRNAADNCPRTPNPDQRDSDRDGVGDACDNCPQKGNADQKD
VDHDLVGDACDSDQDQDGDGHQDSRDNCPTVPNSSQQDTDKDGLGDACDDDDDNDGVPDS
HPPGPDNCRLVPNPNQEDADGDGVGDACQGDFDADKVVDKIDVCPENAEVTLTDFRAFQT
VVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTLTDDDY
AGLIFGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWH
TGDTNDQVKLLWKDPRNVGWKDKTSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTT
MRGGRLGVFCFSQENIIWANLRYRCNDTIPEDYETYRLQHN
Download sequence
Identical sequences G3W6L3
ENSSHAP00000011068 ENSSHAP00000011068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]