SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000011199 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000011199
Domain Number 1 Region: 342-479
Classification Level Classification E-value
Superfamily C-type lectin-like 7e-32
Family C-type lectin domain 0.0005
Further Details:      
 
Domain Number 2 Region: 1218-1359
Classification Level Classification E-value
Superfamily C-type lectin-like 8.47e-31
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 3 Region: 196-329
Classification Level Classification E-value
Superfamily C-type lectin-like 1.2e-29
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 4 Region: 928-1073
Classification Level Classification E-value
Superfamily C-type lectin-like 1.69e-29
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 5 Region: 785-914
Classification Level Classification E-value
Superfamily C-type lectin-like 1.45e-27
Family C-type lectin domain 0.00096
Further Details:      
 
Domain Number 6 Region: 1094-1212
Classification Level Classification E-value
Superfamily C-type lectin-like 2.53e-27
Family C-type lectin domain 0.0019
Further Details:      
 
Domain Number 7 Region: 634-775
Classification Level Classification E-value
Superfamily C-type lectin-like 3.71e-27
Family C-type lectin domain 0.002
Further Details:      
 
Domain Number 8 Region: 487-621
Classification Level Classification E-value
Superfamily C-type lectin-like 6.12e-23
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 9 Region: 6-131
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.3e-22
Family Cysteine rich domain 0.0087
Further Details:      
 
Domain Number 10 Region: 135-191
Classification Level Classification E-value
Superfamily Kringle-like 1.2e-21
Family Fibronectin type II module 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000011199   Gene: ENSSHAG00000009638   Transcript: ENSSHAT00000011293
Sequence length 1437
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849627.1:569411:682972:-1 gene:ENSSHAG00000009638 transcript:ENSSHAT00000011293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IEWDSKGIFIIQNEDLMTCIQASKFGLVLENCKQPTTSMLWKWVSKRHLYNINTNTCLGL
NLSAPEQPLGLFECDSTHFSMWWRCYRKAVIGPYQHMLEVKNRKLVVTTRQSSQKWIQYM
SGGDNVCEHPFQGIELYTVKGNSHGMPCVFPFQYNGQWHYECIREGREDGQPWCATTSRY
EKDEKWGFCPDPTSTAISCEVFWEKDPSTHICYQFNLFSILSWSEAHSSCKMQGGDLLSI
MDDSEENFIRQHLSTKAVDVWIGLNQLDATAGWQWSDGTPLTYLNWSPDVKFDPFLEHHC
GTFNSLMTQSWRSHECESGLPYVCKKYLNRTERKIFVIFKMKKDTWKYYPTHCEPGWNPY
NHNCYQLHKERKPWKTALHSCQSSNSELINLASLAEVEFFITLLRDENVSETWIGMSSQS
IPVFFEWSNGSSVTFTNWHTQEPNIFLNSSQFCVSAQQSEGWWKVKNCEEKISFICKKTG
HVLSEIKSYCHEGWERHGGFCYKIDTIRRSFEHASSGYYCPPSLVTVTNRFEQAFITSLI
SSVVKTEDSYFWIALQDQNVTGEYTWKTAGQKDEPVQYTNWNKYQPSYSGGCVVIRGRNP
PGFWEVKDCKKFKAMSLCKQPVTIRKETEHEERWPFHPCVLGWESKPSLTSCYKVFHSEK
VLMKRTWREAEAFCEDFGAHLASFSHIEEENFVNELLLTKFNWTEERQFWIGFNKRNPLS
EGSWEWSDGTPVIASFLENTYLGEDARNCAVYLANKTLLPLMCGSKREWICKIPRGVKPK
IPNWYKHDEPWLFHQGTEYLFHSDPSEWMSFEFVCGWLRSDILTIHSALEQEFIHSRIKM
LSKNNKNWWIGLREERPNDGFHWRDGSPLIYQNWDNKGERSVNNQSQRCGFISSKTGLWS
NEDCSVPMSSICKRKKIWVIEKERDVPKQYGLCPKGWLYFDYKCFLVETPKDPKHQRTWK
SAQNFCAEENGTLASIQNEVEQAFITMNLFGQKVNVWIGLQSDDYEKWLNGEPVIYSNWS
PVEILNSKSHNSTNIQEQVPLCALLSSNPNFHFTGKWYLEDCGEKFGFVCEKTQVTDASG
HYINESNMYPIPETLEYGNKTYKIIGANMTWHAALKACMENGAELVSITDQFVQSFLTVI
INRLGHAHWIGLFTSDNGLNFEWSDGTKPYFTYWEEESSSSSVGDCTFVAINGRWRRTDC
ETLLQGAICYVKGPQTKQPEYPTLCRETSIPWIKFKNNCYSFSTVLNRTNFDTAQEFCRK
KGANLLTIKDEAENAYLLKELFAFSSSILMVWLNAQFDNKSGTPAWFDGSPIEHSNWGIR
EPESNVFKADLCFALRTTDGVWQLSPCREKNGFICKMETDINNMKPGEAPNHSLIPLTVA
VILVTIFGISTFFYCLYKQNGGFFRRLITWSSAPYTSTNLRLPVEESILISDLERND
Download sequence
Identical sequences G3W6Z4
ENSSHAP00000011199 ENSSHAP00000011199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]