SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000011619 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000011619
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily PH domain-like 1.97e-38
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000234
Further Details:      
 
Domain Number 2 Region: 185-253
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 9.55e-26
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000639
Further Details:      
 
Domain Number 3 Region: 373-435
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000000811
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000011619   Gene: ENSSHAG00000009984   Transcript: ENSSHAT00000011715
Sequence length 448
Comment pep:known_by_projection scaffold:DEVIL7.0:GL861652.1:618817:711538:-1 gene:ENSSHAG00000009984 transcript:ENSSHAT00000011715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSAVVQLYAADRNSMWSKKCCGVACLVKDNPQRSYFIRVFDIKDGKLLWEQELYNNFVY
NGPRGYFHTFAGDTCQVGLNFANEEEAKKFRKTVTDLLGRRQRKSAEKRRDPPNGRKRMK
PPPPPPPQEISSPNLPMATVDIKNPEITTNRFYGPQVNNISHNKEKKKGKTKKKRLTKAD
IGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDLCGISEAQLKDKETSKVIYDFIEKT
GGVEAVKNELRRQAPPPPHSSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPAPPPPP
PPSRGGPPPPPPPPHSSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPVHPSSAPSGP
PPPPPPLSVAGLSCSGRDALLDQIRQGIQLKSVSDGQDSVPPTPAPTSGIVGALMEVMQK
RSKAIHSSDEDEDEDEDEDFEDDDEWDD
Download sequence
Identical sequences G3W864
ENSSHAP00000011619 ENSSHAP00000011619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]