SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000011656 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000011656
Domain Number 1 Region: 248-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000272
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 2 Region: 429-476
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000502
Family Laminin-type module 0.0069
Further Details:      
 
Domain Number 3 Region: 377-426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000837
Family Laminin-type module 0.0087
Further Details:      
 
Domain Number 4 Region: 314-379
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000698
Family Laminin-type module 0.037
Further Details:      
 
Domain Number 5 Region: 75-180
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000132
Family N-terminal domain of xrcc1 0.058
Further Details:      
 
Domain Number 6 Region: 532-578
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family Laminin-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000011656   Gene: ENSSHAG00000010013   Transcript: ENSSHAT00000011752
Sequence length 1170
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856783.1:623963:686834:-1 gene:ENSSHAG00000010013 transcript:ENSSHAT00000011752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLLLMLMALPGLHAQQACSRGACYPPVGDLLVGRTRFLKASSTCGMTKPETYCTPYGEW
KMKCCKCDSRLPHGYNSHRVENVLSSSGPTRWWQSQNDVSPVSLQLDLDRKFQLQDIMLD
LQGPLPAGMLIEHSPDFGKTWKVYQYLAPNCAATFPQLRQGRPQSWQDVRCQPLSTQHTG
PNRGGKVHLNLLDLASGIPATQSQKIHELGEITNLRINFTRLASVPQRGYHPPSAYFAVS
QLRLQGSCFCHGHADSCAPLPGIPADPSARVQVHEVCVCQHNTAGLTCDRCAPFYNNRPW
KAADDQNPHECQRCECNGHSETCHFDPAVFAASQGVSGGVCDNCQDHTEGNNCERCQLHY
FRNRRPGAPIQETCIPCECDPDGAVPGAPCDPLTGQCVCKENVKGERCDLCKPGFTGLTY
TNPQGCTRCDCSILGSRRDMPCDEETGRCLCLPNVVGPKCDQCAPNYWKVASGRGCEPCN
CDPHNSYSPQCNQFTGQCQCREGFDGPTCSAASIRQCPDRSYGDSGTACRACDCDFRGTE
GPGCDKTTGQCLCRPGFVGPRCDQCQRGFCDNYPICVVCHSCFQTFDRNIREEALRLRSL
LNITAGLRPGSGLGDHVLGPRIGEAENSIRQIHAILRTPSVTEQEITEVANIIFSFRRTL
QNLQTNLPLEEETDSLLEELENLDRSLKLLLIQYQNKREQFERISSTDPSGSFRMLNSAY
QTSSQAVQRIASSSNLLLQVHDSRKEAERLERQLEGSGSAGGSQLQTLRQQMASFPNLTP
TINKICGTTRQETCTPGQCQGITCPRDNGTACGADCRGILRQAGGAFRIAKQMSQQLQDF
NAQLQQTRQMIREAEEAATQIQTDAQRLEIQVSNSRSQMEEDVRRTRLLIQQVRDFLTDP
STDAATIQEISESVLALWLPTDSATVLRKMNEIQAIAARLPNVDLILSQTKQDITRARKL
QEEAELARSRAITVEGQVEDVVENLRQGMVALQEAEDTMLGTSRSLGLLQDRITEVQQVL
APTERMVTGMTEQLTSFRDRIEQLRHSIGEQREQSAQAQEIAQGASEHALSAQQGFERVK
QKYKELKNRMGQSPMLGEQGSRILNVKSEAEELFEETMTMMDRMKDMEVELLMGSQDIIR
RSADLTGLEKRVEKIRDHINERVLYYATCQ
Download sequence
Identical sequences G3W8A1
XP_012403314.1.9362 ENSSHAP00000011656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]