SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000011740 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000011740
Domain Number 1 Region: 603-659
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-18
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 566-616
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.63e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 644-696
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000167
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 100-204
Classification Level Classification E-value
Superfamily SET domain 0.00000000000155
Family Histone lysine methyltransferases 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000011740   Gene: ENSSHAG00000010080   Transcript: ENSSHAT00000011836
Sequence length 816
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856934.1:633898:656701:1 gene:ENSSHAG00000010080 transcript:ENSSHAT00000011836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDFYLEKLVDTTLAATQCSSDTVNFPTLVEGAEGTMKMDMEDADMTLWTEADFEEKCTY
IVNDHPWDSGADGGSAIQAEASLPRNLVFKFATNCKEVIGVISKEYIPKGTRFGPLIGEI
YTNDTVPKNANRQYFWRIYSNGELHHFIDGFNEEKSNWMRYVNPAHSVQEQNLAACQNGM
NIYFYTIKPIPANQELLVWYCRDFAERLHYPSSGELMKMNLTQTHISSKQQSTEKNELCP
KSVPKREHSVKEILKNDSSHSKGKSFFHPNISLITPEKDMDDFRKNCSPERPICPRVIYP
IRVPNAEDLLKASLTYRMERPTYITHSPIPSSTTPSPSAISSPDQSLKSSSPHGSLGDTV
SPLAPISQEHRESYPYLNTHYGTEGLGSYPGYIPPSHLPPAFFPSYNTHYPKLLLPPYGM
SCNSLSTVNNINGINNFNLFPRLYPVYGNLPHSMFNSALPNSLPSEGSRRLLQPEHPRDV
LVPAPHSAFSITSAATSMKDKPCSPTSGSPTAGDTSEHMIQPKATSTILADNRSEEAINL
IKSKRNMTGYKTLPYPLKKQNGKIKYECNVCSKTFGQLSNLKVHLRVHSGERPFKCQTCN
KGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKLCPAKFT
QFVHLKLHKRLHTRERPHKCTQCHKSYIHLCSLKVHLNGYCPLDPTSGLSMEDLTRINEE
IEKFDISDNADRLEDTEDGTDMTSVVEKEILALLRREMDGANLKMSLQRNMGNGLISSGC
NFYESSDPSLMKLPHSHPLPLLPVKVKQETVEPMDP
Download sequence
Identical sequences G3W8I5
ENSSHAP00000011740 ENSSHAP00000011740 XP_003769374.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]