SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000011837 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000011837
Domain Number 1 Region: 706-760
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000307
Family Laminin-type module 0.0000676
Further Details:      
 
Domain Number 2 Region: 602-653
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000474
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 3 Region: 164-222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000307
Family Laminin-type module 0.031
Further Details:      
 
Domain Number 4 Region: 813-863
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000865
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 5 Region: 762-810
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000165
Family Laminin-type module 0.00033
Further Details:      
 
Domain Number 6 Region: 323-370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000949
Family Laminin-type module 0.0062
Further Details:      
 
Domain Number 7 Region: 276-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000402
Family Laminin-type module 0.0091
Further Details:      
 
Domain Number 8 Region: 220-278
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000809
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 9 Region: 651-708
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000352
Family Laminin-type module 0.0002
Further Details:      
 
Domain Number 10 Region: 953-1177
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000196
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.01
Further Details:      
 
Domain Number 11 Region: 861-906
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000209
Family Laminin-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000011837   Gene: ENSSHAG00000010160   Transcript: ENSSHAT00000011934
Sequence length 1487
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856757.1:644912:775223:1 gene:ENSSHAG00000010160 transcript:ENSSHAT00000011934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAGVRYPSTITLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTQEDGPWIPYQYYSGSC
ENTYLKPNRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQE
WVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKKDFDK
LVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCNCNGRSQECYFDPELYRSTG
HGGHCTNCQDNTDGANCERCRENFYRLGNEEACLPCHCSPVGSLSTQCDNYGRCSCKPGV
MGDKCDQCQPGFHSLTEAGCRPCSCNPAGSTDECNVETGRCVCKDNVEGFSCERCKPGFF
HLESSNPRGCTPCFCFGHSSVCTNAEGYSVHSITSTFQIDKEGWRAEERDGSETSLQWSS
ESQEISVISESYFPIYFIAPDKFLGNHLLSYGQNLTFSFRVERRDTRLSAEDLVLEGAGL
RVSVPLIAQGNSYPSETTVKYIFRLHEATDYPWRPTLTPFEFQKLLNNLTSIKIRGTYSE
RSAGYLDDVTLASAQRGPGVPAVWVESCTCPVGYGGQFCQLCVSGYKRETPSLGPYSPCV
LCTCNGHSETCDPETGVCNCRDNTAGPHCEKCVDGYYGDSTAGTSSDCQPCPCPGGSSCA
VVPKTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGENGPTRLCRLCQCSDNIDPNAVGNC
NRLTGECLKCIYNTAGFYCDRCRDGFFGNPLAPNPADKCKACSCNPYGTVNQQTTCNQVT
GQCECLPHVTERDCSICDPGFYNLQSGQGCERCNCHALGSTNGQCDIRTGQCECQPGITG
QRCEQCEPNHFGFGPEGCKPCDCHPEGSLSLQCKDDGRCECKEGFVGNRCDQCEENYFYN
RSWPGCQECPACYRLVKDKVAEHRVKLQELENIIANLGTGDETVTDQAFEDRLKAAERDV
MDLLREAQDIKDIDQNLMDRLQRVNNTLSSQISRLQNIRNTVEETGNLAEQARTRVESTE
RLIEIASRELEKAKVAIANVSITQPDSIGDPNNMTLLAEEARKLAERHKKEADDIVRVAK
TANDTSTEAYNLLLRTLAGENQTANEIEELNKKYEQAKNLSRDLEKQATRVHEEAKRAGD
KAVEIYASVAQLTPVDSVALENEANKIKKEAEALDQMMDKKLSDYEDLREDMKGKELEVK
DLLEKGKAEQQVSPGATERARALASKHPPFALVGPSATPSPRSAGIASPPGLVREGRERT
HAAPFRSCARLAPRDSARPGAVLVSALALAGPAVGATRKLRNRGDRKRALFAVVQQNATS
TKAEAERTFADVTNLDKEVDDMLKQLQEAEKELKKKQDDADQDMMMAGMASQAAQEAEIN
ARKAKNSVSSLLTIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVTDLE
NEAKKQEAAIVDYNRDIEEIMKDIRNLEDIKRSLPSGCFNTPSIEKP
Download sequence
Identical sequences G3W8T2
ENSSHAP00000011837 ENSSHAP00000011837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]