SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000012035 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000012035
Domain Number 1 Region: 21-136
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.81e-36
Family MBT repeat 0.00000928
Further Details:      
 
Domain Number 2 Region: 111-212
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.42e-34
Family MBT repeat 0.00000366
Further Details:      
 
Domain Number 3 Region: 559-633
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.36e-19
Family SAM (sterile alpha motif) domain 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000012035   Gene: ENSSHAG00000010320   Transcript: ENSSHAT00000012133
Sequence length 635
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849805.1:667755:761844:1 gene:ENSSHAG00000010320 transcript:ENSSHAT00000012133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEHFNWDSYLRETGSLAAPSQCFRQSKIPPTNDFKVGMKLEARDPRNVTSVCIATVIGIT
GARLRLRLDGSDNKNDFWRLVDSSDIQPIGTCEKKGGMLQPPLGFQMNASSWPMFLLRTL
NGAEMAPAAFFKKEPPKPAPNLLKTGMKLEAIDKKNPYLICPATVGDVKGDDVFITFDGW
RGAFDYWCRYDSRDIFPVGWCGLTGDALQPPGNNVIVLRQNPSPPSSDVGWKKPSMNVPK
ILLKTAPISAQRGKKPVPKKGRSPKNVSLTKTISHTENLKTRKKGLKPGRKLKIRTFAGP
PVTYSVTCTPSTSRTEHREIPKGQVFFPPVCVYVNKHGNSGPHLDKKKVQLLPDHFGPGP
VNVVLRQAVQACVDCAHQVKMVFGFLKSGHHGGETITASFDGEKHATNLPSVNSASFVLR
FLEKLCHSLQCDNLFSSQPFSPYMGTAHSPTDYDRNKPGDKFIIGSSTLKFITQHYNFLH
FNFLRLSLPSSWTLPTYPKYTPVLFICVGLPISFFSVKRQKNSRSILKFTDAENKVLSLW
SASSTTGPDLNVLKREPSRGSNKDPSNWSIDEVMRFVKEADPQALAPHAELFRRHEIDGK
ALLLLRSDMIMRYMGLKLGPALKLCYHIERLKQGD
Download sequence
Identical sequences G3W9D0
ENSSHAP00000012035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]