SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000012187 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000012187
Domain Number 1 Region: 1016-1105
Classification Level Classification E-value
Superfamily PDZ domain-like 6.31e-26
Family PDZ domain 0.00026
Further Details:      
 
Domain Number 2 Region: 398-500
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-23
Family PDZ domain 0.0000659
Further Details:      
 
Domain Number 3 Region: 841-938
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-22
Family PDZ domain 0.00012
Further Details:      
 
Domain Number 4 Region: 701-813
Classification Level Classification E-value
Superfamily PDZ domain-like 7.49e-22
Family PDZ domain 0.00043
Further Details:      
 
Domain Number 5 Region: 566-667
Classification Level Classification E-value
Superfamily PDZ domain-like 4.73e-18
Family PDZ domain 0.00027
Further Details:      
 
Domain Number 6 Region: 123-195
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.53e-16
Family Nucleotide and nucleoside kinases 0.0038
Further Details:      
 
Domain Number 7 Region: 290-326
Classification Level Classification E-value
Superfamily WW domain 0.000000000000475
Family WW domain 0.0014
Further Details:      
 
Domain Number 8 Region: 337-372
Classification Level Classification E-value
Superfamily WW domain 0.000000000626
Family WW domain 0.003
Further Details:      
 
Domain Number 9 Region: 66-111
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000434
Family PDZ domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000012187   Gene: ENSSHAG00000010442   Transcript: ENSSHAT00000012285
Sequence length 1476
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856992.1:687066:905033:1 gene:ENSSHAG00000010442 transcript:ENSSHAT00000012285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKTLKKKKHWLSKVQECALSWAGPPGDFSAEIRGGAERGEFPYLGRLREEPGGGTCCVV
SGKAPSPGDVLLEVNGTPVSGLTNRDTLAVIRHFREPIRLKTVKPGKVINKDLRHYLSLQ
FQKGSIDHKLQQVIRDNLYLRTIPCTTRAPRDGEVPGVDYNFISVEQFKTLEESGTLLES
GTYDGNFYGTPKPPAEPSPFQPDPVDQVLFDNDFDTESQRKRTTSVSKMQRMDSSLPEEE
EEEDKEAVNGSGSAENKERHSESSDWMKTVPSYNQTNSSMDFRNYMARDENLEPLPKNWE
MAYTDTGMIYFIDHNTKTTTWLDPRLCKKAKAPEDCEDGELPYGWEKIEDPQYGTYYVDH
INQKTQFENPVVEAKRKKQLGQTDVGSSKQGIDVEKSHFTRDPSQLKGVLIRASLKKSTM
GFGFTIIGGDRPDEFLQVKNVLKDGPAAQDGKIAPGDVIVDINGNCVLGHTHADVVQMFQ
LVPVNQYVNLTLCRGYPLPDDNEDPVVDIVTATPIINGQPVTKGETCISSQDFKSGTVVM
DQNGKSGHILGSDRLNGPSLDPNEQRASMASSGSSQPELVTIPLIKGPKGFGFAIADSPS
GQKVKMILDSQWCHGLQKGDIIKEIYHQNVQNLTHLQVVEVLKQFPVGTDVPLLILRGGP
PSPAKTTKVKTDKQENSGSLEAINESVPQPMPFPPSIIRSGSPKLDPSEVYLKSKTIYED
KPPNTKDLDVFLRKQESGFGFRVLGGDGPDQSIYIGAIIPLGAAEKDGRLRAADELMCID
GIPVKGKSHKQVLDLMTTAARNGHVLLTVRRKIFYGEKQPEEDDLQTFISAQNGSPRMNR
AEGTTRPPEAYDVVLQRKENEGFGFVILTSKNKPPPGVIPHKIGRVIEGSPADHCGKLKV
GDRISAVNGKSIIELAHDNIVQLIKDAGITVTLTVIAEDEHHGPPSGTNSARQSPALQHR
PMGQTQAGHTTGERSGLESEIGKDVSMTYRLSWSDHKHLAQPDTALISIVGNRHNQNLGC
YPVELERGPRGFGFSLRGGKEYNMGLFILRLAEDGPAIKDGRIHVGDQIVEINGEPTQGI
THTRAIELIQAGGNKVLLLLRPGTGLIPDHGDWDIFNPSSSSVIYDEQSPYLPSLYSTSI
FEISHVPVSEEALMRIQICEKVEELKDTLPVKKSPTNENNSEIKHQSSVQKNVNKKVQPS
SQGHGEKRIHQEVENDVARRGRSVSPKKTVNRPSGDHGEKIASPLKGDPKRRPKDRSLSP
KKRENKNLQVGTNEGSGKDKSKKPRGRSVSPQKQPKMEVLRDKLSTEAGLQEGEEKRPSE
NTEMTKNEKEKLTISKRDPKQNQSGKNEASSLEKKSQKTDEKSLPSKRANEPGSKVVAEN
EKGKKANSGEISCSKSKTGPSSKMSKKPPKLESEETDIRNKAGEQKEKDPEKVERKKDSL
GLKPGSISPVKKIPITPGPWKVPSANRVLGVAEKRL
Download sequence
Identical sequences G3W9T2
ENSSHAP00000012187 ENSSHAP00000012187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]