SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000012871 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000012871
Domain Number 1 Region: 387-455
Classification Level Classification E-value
Superfamily TB module/8-cys domain 9.42e-20
Family TB module/8-cys domain 0.0004
Further Details:      
 
Domain Number 2 Region: 1064-1132
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.76e-19
Family TB module/8-cys domain 0.0000153
Further Details:      
 
Domain Number 3 Region: 1239-1301
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.32e-17
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 4 Region: 739-879
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000121
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 5 Region: 631-756
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000439
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 6 Region: 268-336
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000157
Family TB module/8-cys domain 0.0031
Further Details:      
 
Domain Number 7 Region: 586-641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000158
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 8 Region: 335-382
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000182
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 9 Region: 920-1048
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000612
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 10 Region: 1377-1428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000209
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 11 Region: 1347-1392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000342
Family EGF-type module 0.013
Further Details:      
 
Domain Number 12 Region: 1184-1229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000045
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 13 Region: 1146-1192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000499
Family EGF-type module 0.011
Further Details:      
 
Domain Number 14 Region: 119-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000115
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000012871   Gene: ENSSHAG00000011010   Transcript: ENSSHAT00000012977
Sequence length 1439
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834680.1:949828:1235984:1 gene:ENSSHAG00000011010 transcript:ENSSHAT00000012977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSNRVTPLSSQNLMIHHGQMQEYVIKPKYFPAQKMISGEQSTEGSLPLRMRQDHIVSPFQ
LSNHTGRIKVVFTPSICKVTCTKGSCQNNCEKGNTTTLISENGHAADTLTATNFRVVICH
LPCMNGGQCSSRDKCQCPPNYTGKLCQIPVHGANAPKLYQHPQQSNKGLGTHIVHSTHTL
PLTMTGQQGVKVKFPPNIVNIHVKHPPEASVQIHQVSRIDGSTGQKMKESQPGQSQISYQ
GVPIQKTQTIHSTYSHQQLVPHVYPVAAKTQLGRCFQETIGSQCGKALPGLSKQEDCCGT
VGTSWGFHKCQKCPKKPAYPMYSQMMECPQGYKRVNATFCQDINECQMQGACPNGECLNT
LGSYRCTCKLGFVPDPTLSTCIPDNPVISEEKGPCYRLVNSGRQCMHPLSVQLSKQLCCC
SVGKAWGPHCEKCPLPGTAAFKEICPGGMGYTVSGVHRRRPVHHHIGKGPIYIKPKNIQP
VAKSTHPPPLPAKEEPVEALTFSQEKGPQVDVQVVATAAPEKELVDQEKTKLEPGQPQLS
PGISTINLHPQYPVVIEKTSPPVPVEVAPEASTSSASQVIAPTQVTEINECTVNPDICGA
GHCINLPVRYTCICYEGYKFSEHQRKCVDIDECTQIHHLCSQGRCENTEGSFLCICQAGY
MANPEGTDCIDVDECLRPETCGDGHCINTIGAFKCEYCDNGYRMNGRGQCEDIDECLTAS
TCPDEQCINTPGSYQCVPCTEGFRGWNGQCLDIDECLDPKVCRNGSCSNLEGSYMCTCHK
GYNPTPDRKQCKDIDECQHGNLCTHGHCKNTEGSFKCTCGKGYHLSAAKDQCEDIDECEH
HHLCTNGQCRNTEGSFRCLCDQGYRASAVGDHCEDINECWNVKHLLWRQRVVSTSNTYFI
ECELVENGDTQSQKNKQLSDINECEQTDLCGPHGECLNTDGSFHCICEQGFSISADGRTC
EADIDECVNNTICDSHGFCDNTAGSFRCLCYQGFQAPQDGQGCVDVNECEMLSGICGEAF
CENVEGSFLCMCSDENQEYNPMTGQCRSRSSTEAEVDLPEEEKEEKKECYYNLNDANFCD
NVLTSNVTKQECCCTLGAGWGDNCEIFPCPVFGTELAEFTEMCPEGKGFIPTSHSSHTVT
GQNYKDADECQLFGQEICKHGFCLNTQPGYECYCKQGTYYDPVKLQCFDMDECQDPNSCI
DGQCINTEGSYNCFCTHPMVLDSTEKRCIRPTDSNEQTEETDVYQDLCWEHLSDEYVCSR
PLVGKQTTYTECCCLYGEAWGMQCALCPMKDSDDYAQLCNIPVTGPRRPYGQDALVDFNA
HYSPETDPYFVQDRFLNSFEELQAEECGILNGCENGRCVRVQEGYTCDCFDGYHLDMTKM
TCVDVNECDELNNRMSLCKNAKCINTEGSYKCLCLPGYVPSDKPNYCTPLNPEKDSDLE
Download sequence
Identical sequences G3WBR6
ENSSHAP00000012871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]