SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000012973 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000012973
Domain Number 1 Region: 1-55
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1e-22
Family Tudor domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000012973   Gene: ENSSHAG00000011098   Transcript: ENSSHAT00000013079
Sequence length 645
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856793.1:797099:836386:-1 gene:ENSSHAG00000011098 transcript:ENSSHAT00000013079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSRKFGDGEVVRGRWPGSSLYYEVEVLSQDSKSHLYTVKYKDGTELELKESDIKPLTSF
RQRKSGSSSSSPSRRRGSRSRSRSRSPGRPPKSLRRSASQHAEIKEKKEMLEINLTPLKQ
SGNSISRYNGEPDRIERNDIAHRNIQNKSYLSQESSYLATQYSLRPRKEEIKFEEIISKE
ERNITKGPKSLRTFEMTATEPEDFEFGGGFGAFSIMIGLPVMLFMLLLMCREEDPSLANL
PPPLPPLANLWETRVFGVCLLWFFLQALFHLLPIGKVVEGTPLCSGRRLKYRLNGFYAFI
LTSVVIGTSLYWGIELYYVYDHFLQFAVAATVFSVALSIYLYVRSLKAPKDELSPGKSGN
IVYDFFIGRELNPRIGHFDLKYFCELRPGLIGWVVINLIMLLAEMKVQQRETPSVAMVLV
NSFQLVYVVDALWNEEALLTTMDIIHDGFGFMLAFGDLVWVPFVYSLQAFYLVRHPNEVS
WLFASIIIALKLSGYVVFRCANSQKNAFRKNPNDPNLAHLKIIHTSSGKNLLVSGWWGFV
RHPNYLGDLIMALSWSLPCGFNHILPYIYVIYFTILLIHREARDEHQYHQSPGQNLGWEE
EGTGRLTEEVISGSASSQLLNMITMKELFFHSLSSDSNTTRLVIQ
Download sequence
Identical sequences G3WC18
ENSSHAP00000012973 ENSSHAP00000012973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]