SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000013647 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000013647
Domain Number 1 Region: 827-845,901-1033
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-17
Family Laminin G-like module 0.025
Further Details:      
 
Domain Number 2 Region: 127-170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000464
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 3 Region: 89-131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000493
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 4 Region: 165-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000628
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 5 Region: 670-794
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000907
Family Laminin G-like module 0.039
Further Details:      
 
Domain Number 6 Region: 1130-1172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000453
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 1061-1102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000617
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 8 Region: 243-284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000622
Family EGF-type module 0.0037
Further Details:      
 
Domain Number 9 Region: 203-242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000018
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 10 Region: 1214-1254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000243
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 339-369
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000113
Family EGF-type module 0.01
Further Details:      
 
Domain Number 12 Region: 54-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000183
Family EGF-type module 0.012
Further Details:      
 
Domain Number 13 Region: 1096-1132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000195
Family EGF-type module 0.011
Further Details:      
 
Domain Number 14 Region: 319-419
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000173
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 15 Region: 823-873
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000698
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000013647   Gene: ENSSHAG00000011663   Transcript: ENSSHAT00000013759
Sequence length 1324
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834637.1:885639:909881:1 gene:ENSSHAG00000011663 transcript:ENSSHAT00000013759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CEELYDACSERVCPHNQTCHAAPGALNHTCRCPPGSWGPTCDTAGCGDHGCPGSCAVQPC
HHGGTCLAAGAGSACLCLPGWTGPLCEEDVDECKSGPCQNGALCVNDPGGFLCYCVPGFQ
GPHCELDINECASRPCKHEASCINRVDGYQCLCSPGYTGLNCETEIDECESDPCQNGGSC
LDGIGTYQCLCSPGFTGHNCQVDIDECESQPCANGGICQNFINRFQCDCGGTGFEGALCE
VEVLECLSSPFLHIATCLEGLGNYTCVCLPGYHGEHCEMDEDDCAGDPCLHGGLCLQRSN
QSLYGGAQPVFPGTFSYSSAAGFVCQCLPGFAGDNCSVDVNECESHPCQNGGTCEDLPNS
FQCHCLAGLLSRPFFSGEDCGQFSLCSLLPSSSPHSVSLSALSACLSLSPHSLSSLCNSQ
VTGSLVLSSMLSSSDVFWSPFLKVMIAFVFISLPLLNICYHFSLSQRAFSLNKELNVSEL
LPLGGATGILHISCRVMIEAGLGSNRAGVSPQSPSLFLSVSLFLTLSLSFSSFSPSLSLF
LSFPPLPASISFSLTASFISGGGGCGLQGVLWPTARSLMKKSPAPGLMYNSCTLQVTGRH
VEEEGREGSQTFSCLSGLMGASWRGDGRSWISLPCRWERREGPLCHSWVGQEAGEDGGAQ
LGHLLRAWDSSQGSTLDLRISNRGRHLSTLLIRLNSSEHGFLRLWVSRGELRVEVAAAAQ
VVALPGRLDDGHKHLVTLGLGRGQLQGPPLGPSYEVYVGGLASAAWAQPWGGNFKGCLQD
IRLNSLRLDLLPLLQPDNRTGSGGALEGRASNLTLGCVSEDTCRFDPCHNGGTCTVTWND
FICSCPHNFTGPTCAKRLWCQAQPCPPSTTCAEVPDGYVCLANATFQDQPPAVFTSHNMS
AQRELVALSLAFRTRDLEAVLLQAAGEGASLRVAIHNGSLSVSVRSGNSVEGATFGGVAP
VSDGAWHLVSLAMEEPAASLSRWQLRLDEAQNVTLWGQAGTLDFLRHHVRVVLAENFTGC
LGRVTVGGLDLPFARLPTPLPQPEQFLLEGGGVDLGCRGHPVCSAEPCLHGGTCQDLFDA
FSCACGASWNGPRCEVDVDECGSAPCVHGRCRNLPGSYQCQCSAGYTGKHCESDVDDCLE
HSCLHGATCVDGLLSYSCRCPPEFFGPRCQWPFPPEECGRNFTCLNGGHCSDGPWGANCS
CPMGFTGLRCQIRIPECEPNPCQNGGTCQAAGSEVECICSSNFGGRHCDVADLVTLFSFP
LIEVVVPVACGCLLLLLIGLLSGVLAARKRRQSEGTYSPSQQEVAGARLEMDSVLKVPPE
ERLI
Download sequence
Identical sequences G3WDZ2
ENSSHAP00000013647 ENSSHAP00000013647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]