SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000013983 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000013983
Domain Number 1 Region: 229-412
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.6e-30
Family Laminin G-like module 0.0033
Further Details:      
 
Domain Number 2 Region: 4-172
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.3e-28
Family Laminin G-like module 0.00078
Further Details:      
 
Domain Number 3 Region: 168-206
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000013983   Gene: ENSSHAG00000011960   Transcript: ENSSHAT00000014100
Sequence length 432
Comment pep:novel scaffold:DEVIL7.0:GL856902.1:936544:943230:-1 gene:ENSSHAG00000011960 transcript:ENSSHAT00000014100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFAPFHIRQKMYIQLQFQPVSTDGILFYTAQYLNSRSGDFICLSLANGSVQLRYNLGDQ
TIILQSLQKVHTRSFWHVIKAGRVGNEGYLELDGINVTKKATSGMKALDTSTDFYIGGVS
SLSLVNPLAIENEPIGFDGCVREILINNRELKLTETGAKSGSNVGDCDGTLCGYKVCKNR
GKCVAQDSNFSCKCSPHWMGKRCEESIYCRNNMCLHQSHCIPVQPASYICICPLGWVGRY
CENETSFLTAKFVGNSYIKYIDPNYKKRDLQFTTVSLNFSTTETEGLILWMGKAEHEEND
FLAIGFHNQTLNVIVNLGESISVPLINSSALLCYKQWHHVRVVQNQTFIKVYFDGDLIIF
EDIDPTKSYTALNYDGVSYLGGFEFGRGVKMVTQGLFNQDFIGKIKDVVFFQDPQKTELI
KSEGYNIHNGDE
Download sequence
Identical sequences G3WEX8
ENSSHAP00000013983 ENSSHAP00000013983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]