SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000014026 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000014026
Domain Number 1 Region: 637-692
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000000295
Family Tudor domain 0.0000655
Further Details:      
 
Domain Number 2 Region: 271-325
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000638
Family UBA domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000014026   Gene: ENSSHAG00000011994   Transcript: ENSSHAT00000014143
Sequence length 734
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849878.1:941990:1075268:-1 gene:ENSSHAG00000011994 transcript:ENSSHAT00000014143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YLSDEGIEACKSSPDKVNINDIILIALNTDLRTIGKKFLPSDINGGKVEKLEGPCVLQIQ
KIRNVAAPKDNEESQVAPRMLRLQMTDGHISCTAVEFNYMSKISLCTHKGNTVRRLNGWI
DTIDGFIILSVKNGSNMSSMFYQLILPQWSLDLSLSKHNRSNIGTEGGPPPFVPFGQKCV
SHVQVDSRELDRRKTLQVTAPAKPSGDNDEFEKQRTAAIAEVSKGKETKTFGGGGGNARS
NLNMSTGGNRNREVFQKEKITKPEGKYEGVYRELVDEKALKHITEMGFSKEASRQALMDN
GNNLEAALNVLLNSNKQKPVLGPPMRGKGKGRGRGRCEDEEELGNSRPSAPSTLFDFLES
KMGSLNMEESKAQSQPLHQGQHRLLNNEQNGVKDYNQPRHLPRNDTRQPRNEKPPRFQRD
TQNSRQILENSGLPRSRGPERQSSSVVHEAWTEERIKCDRPYARNDRIKDIAYPSTSHQN
DGAFKKRDNSMQNRPGKGPSYLEVKESPLPQETIDHNNQKRGKRENQISNPDQLYERKTR
TISNEAFSGMKNEKHFNMNTDYPNSVRTDGFSGVPNGEVEVSMKGRRVGPIKSAGSTGAP
AFDDKMLFYNSGPKRRSGPIKPEKVLESSLPVECGRMWKPGDECFALYWEDNKFYRAEIE
ALHSSGMTAVVKFSDYGNYEEVLLSNIRPIQAEAWEEEEGTYDQTLEFRRGGDGQPRRST
RPTQQFYQPPRARN
Download sequence
Identical sequences G3WF21
ENSSHAP00000014026 ENSSHAP00000014026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]