SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000014608 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000014608
Domain Number 1 Region: 349-489
Classification Level Classification E-value
Superfamily C-type lectin-like 1.52e-42
Family C-type lectin domain 0.00046
Further Details:      
 
Domain Number 2 Region: 928-1078
Classification Level Classification E-value
Superfamily C-type lectin-like 7.52e-39
Family C-type lectin domain 0.00025
Further Details:      
 
Domain Number 3 Region: 1215-1354
Classification Level Classification E-value
Superfamily C-type lectin-like 5.6e-38
Family C-type lectin domain 0.00021
Further Details:      
 
Domain Number 4 Region: 632-777
Classification Level Classification E-value
Superfamily C-type lectin-like 1.1e-37
Family C-type lectin domain 0.00000345
Further Details:      
 
Domain Number 5 Region: 785-921
Classification Level Classification E-value
Superfamily C-type lectin-like 8.93e-36
Family C-type lectin domain 0.00033
Further Details:      
 
Domain Number 6 Region: 495-636
Classification Level Classification E-value
Superfamily C-type lectin-like 2.53e-32
Family C-type lectin domain 0.00097
Further Details:      
 
Domain Number 7 Region: 21-152
Classification Level Classification E-value
Superfamily Ricin B-like lectins 9.07e-32
Family Cysteine rich domain 0.00000146
Further Details:      
 
Domain Number 8 Region: 1083-1210
Classification Level Classification E-value
Superfamily C-type lectin-like 4.22e-31
Family C-type lectin domain 0.00079
Further Details:      
 
Domain Number 9 Region: 229-342
Classification Level Classification E-value
Superfamily C-type lectin-like 1.69e-28
Family C-type lectin domain 0.00071
Further Details:      
 
Domain Number 10 Region: 152-210
Classification Level Classification E-value
Superfamily Kringle-like 1.31e-19
Family Fibronectin type II module 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000014608   Gene: ENSSHAG00000012471   Transcript: ENSSHAT00000014730
Sequence length 1449
Comment pep:known_by_projection scaffold:DEVIL7.0:GL861686.1:1037959:1131121:-1 gene:ENSSHAG00000012471 transcript:ENSSHAT00000014730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRLPIIIIIISCPILNLLRDTKQFLIYNDDHKRCVNVISSSAVQTAVCNPESESQKFRWV
SNTQLMSISLKLCLGVSSKTDWVQVTLFPCDSKSDLQKWECKNDTLFGILGEDLYFNYGN
KQEKNIMLYKGSGLWSRWKIHGTSDDLCSRGYEEIYTLLGNSNGAPCVFPFKFENKWYAD
CTSAGRSDGWLWCGTTTDYEVTRLFGFCPRKFAGSESLWTKDPLTGISYQINSKSALTWH
QARKSCQQQQSELLSITEVSEQTYLTGLTNSLTTGLWIGLNSLSFNSGWQWAGYSPFRYL
NWLPGSPALEPGKSCVLLNPAKNAKWENVECSQKLGYICKKGNSSLNQFIIPSESDVPIS
CPSQWWPYAGHCYKISREPKIQKDAKTTCRKEGGDLASIHSIEEFDFIFSQLGYEDTDTL
WIGLNDLKHQMFFEWSDDTPVTFTKWLPGEPSHANNRQEDCVVMKGKNGYWADHPCEGHH
GYVCKSKPLSTPPVVEVDTGCKKGWKRHGPYCYMIGQTLSTFEVANHTCINQNAYLVTVE
DRYEQAFLTSLVGLRPEKYFWIGLSDVQNKGTFKWTIDENVQFSHWNSLMPGRKTGCVAM
KTGIAGGLWDVLKCEEKAKFVCKHWAEGVTPPPIPTTTPAPKCPDGWISSSKTNLCFKVF
GKSKYSKKTWFDARDFCRAIGGDLARITNKEDQSTIWQNIGTSNYHDVFWLGLTIANTDE
GFTWSDGSPVTYENWSYGEPNNYGNIEFCGELKADPSMRWNDINCELLRKWICHIKKGDE
LKPEPTPSPESNPPVTEDGWVIYKDYQYYFSKEKSTMENARAFCKKNFGDIVTISGESEK
KFLWKYISALDLEATYFIGLLISLDKKFSWMDGSKVDYVAWAPGEPNFANDDENCVVLYT
SSGLWNDINCGFPNAFICQRHNSSINTTASPTPLPPLGGCRWGWKLFQNKCYKIFGAKEE
ERKNWQAARKDCQGYGGNLVSIHSRKEQAFLTTELLESTYDSWIGMNDINSENKFLWTDG
RGVQYTNWAKGFPAGRRSFLSYEDVDCVVIVGGPSLEAGKWIDEICENEKGYICQTDSDP
AQPHPSTPTSGNFIRFGDSSYSVVTSKMKWKDAKEYCEGSSSQIASILDPYVNSFVWLEM
QKHNEPMWIGLNSNLTQGEYAWIDRWRMRYTNWGPGEPQVKSGCVYMDLEGFWKTAPCNE
SYQFLCKKSDVSPATEPPQLPGRCPDSEQSSWIPFSGHCYYIESSSTRSWGQALLECSRM
GASLVSIESAVESTFLTYKVEPLKSKTNFWIGMFKNVEGNWLWIDNTAVSFVNWKTGEPS
NDRNEDCVELYSSSGFWNNLYCSSYKGYICKREKIIDAKATEAIKPNDGPETRKAPKSHN
SAGIIVVVVLLILTGVGAAAYFFYKKRQVQIPQEGNFDNTLYFNTGSISGVSDTKDLMGN
IEQNEHALI
Download sequence
Identical sequences G3WGQ3
ENSSHAP00000014608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]