SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000014905 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000014905
Domain Number 1 Region: 470-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-26
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 750-807
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.86e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 582-639
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.54e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 73-134
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-25
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 5 Region: 526-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.23e-25
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 6 Region: 806-863
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 7 Region: 694-751
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.53e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 8 Region: 638-695
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-24
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 9 Region: 358-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-23
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 10 Region: 414-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.66e-23
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 11 Region: 848-900
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.93e-22
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 12 Region: 305-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-19
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 13 Region: 251-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000913
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000014905   Gene: ENSSHAG00000012717   Transcript: ENSSHAT00000015030
Sequence length 907
Comment pep:novel scaffold:DEVIL7.0:GL841404.1:1087613:1101683:1 gene:ENSSHAG00000012717 transcript:ENSSHAT00000015030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMAALGAGPELSTAPTQVSNSLSTRPKPLCQEIRLPLHDHPHQDALDHPVPAHLPEWSL
GDQAVVAEALPAKLQASLMFKDVAVYLTQEEWGCLGPAQRGLYRDVMLENYGNLVSLGFS
VSKPDVISQLEKGEEPWVLDSHGGGRREILKSDYLDCETKSKKELSPKHKIFEKTELQGI
ILGRFKRPEFEESYKIENQLEKHWEKPVMGAVRKSFSLDRNCKPVTVILKTSARIRGQEC
NAFGRRSYLTSTHVRHQMVPRGEKTHQCATCGQTCKKNSDLINHQSVHTREKACKLNMYG
KMLSQNSISIEHQRLHNTQKSYECNECGKAFSQNRTLIQHKRIHTREKPYECDECGKTFS
CNSILTKHQRIHTGEKPYKCNECGKAFSARSYFFQHHKIHTGEKPYECNDCGKAFSTRSS
FIQHGKIHTGEKPHECHQCGKAFSHSSNLIHHQRIHTGEKPYQCKECEKAFSRHSHLIQH
QRIHTGEKPYECNDCGKAFSARLSLIQHQRIHTGEKPYECNECGKTFSLNRTLIVHQRIH
TGEKPYECNECGKSFSQRSQVIQHKRIHTGEKPYVCSECGKSFSARLSLIQHQRIHTGEK
PYECNECRKTFSQKGHLIQHQRIHTGEKPYECNECGKAFSQSFNLIHHQRTHNGEKPYEC
NECDKAFSVLSSLVQHQRVHNGEKPYECNKCGKAFSQGSHLIQHQRSHTGEKPYECNECG
KTFGQISTLIKHERTHNGEKPYECNECGKAFSQSAHLIRHRRIHTGENPYECNDCGKAFN
VRSSLIQHQRIHTGEKPYECNECGKAFSQHSQFIQHQRIHTGEKPYVCNECDKSFSARLS
LIQHKRIHTGEKPYECNECGKSFRQSSHLIRHQRIHSGERPFTCDECGKTFSQRITLISH
EKIHNRE
Download sequence
Identical sequences G3WHK0
ENSSHAP00000014905 ENSSHAP00000014905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]