SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000015308 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000015308
Domain Number 1 Region: 42-130
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.69e-36
Family SCAN domain 0.0000904
Further Details:      
 
Domain Number 2 Region: 407-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.53e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 575-632
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.79e-25
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 4 Region: 519-576
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 660-716
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-22
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 6 Region: 463-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.47e-22
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 160-220
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-21
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 8 Region: 701-753
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.53e-20
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 9 Region: 369-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000143
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 10 Region: 622-654
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000647
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000015308   Gene: ENSSHAG00000013048   Transcript: ENSSHAT00000015435
Sequence length 773
Comment pep:novel scaffold:DEVIL7.0:GL841491.1:1153454:1171779:1 gene:ENSSHAG00000013048 transcript:ENSSHAT00000015435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLALNKMMSIPLCPNILDVHERDRLIKGASKEQITILTREKFNSEASRQNFRYFPYSEKA
GPREVVNQLWELCFQWLRPEIHTKEQILELLVLEQFLTILPSEIRICVKSQHPENIEEVI
TLVEDLTQILDEKAVSSQDPALLQKGSIEEEKPTVLPVDRFQEMVTFKDVDPDFTWEEWT
QLAPVQQDLYKEVLLENYRNMIFLGLSIPKPDVISQLECGEMPWTLENESSRAICPYFDT
ELEAKEPLSKWETSVEKLSQRTVMERSTRHSSSDSKLGETFKFQGPLVKEQSQQENHLKQ
VMITHEKTLSKEEISESNEFERHFDLRSILITQQKVPIVNGVYKYNIHEKCFKDNSQLTK
CPRIYTAQKSFTYNEFEKSFKPISHLKLCSTHHSAEKSYKCNECGKAFTKWANLTRHQRI
HSGEKPYKCDECGKAFTQRTHLTQHQLTHIGEKPFKCNQCGKAFFQRGHLVQHQHTHIEE
KPFKCNECGKAYSSVSQLNLHQRIHSGEKAYKCNECGKAFTKWANLTRHQRIHSGEKPYK
CNDCEKAFSQRAHLTQHQLIHIGEKPFKCNECEKAFIQVSQLNLHQIIHSGEKPYKCNEC
GKAFTQRTILTQHQKIHSGEKPFKCNACGKAFTKRSNLTQHQHTHIEEKPFKCNICEKAY
SYILQLNIHQRVHSGEKPYKCNECGKAFTKRVILTQHQKIHSGEKPYKCNECCKAFTKQA
NLTRHQRIHSGEKPYKCNDCGKSFTQKPNLIQHQRIHAGDKSLVQGTCVTNVC
Download sequence
Identical sequences G3WIQ3
ENSSHAP00000015308 XP_012398168.1.9362 ENSSHAP00000015308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]