SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000015444 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000015444
Domain Number 1 Region: 863-1044
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.68e-46
Family Ypt/Rab-GAP domain of gyp1p 0.003
Further Details:      
 
Domain Number 2 Region: 1019-1139
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.14e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0047
Further Details:      
 
Domain Number 3 Region: 14-157
Classification Level Classification E-value
Superfamily PH domain-like 1.37e-17
Family Phosphotyrosine-binding domain (PTB) 0.04
Further Details:      
 
Domain Number 4 Region: 158-208,283-369
Classification Level Classification E-value
Superfamily PH domain-like 4.65e-17
Family Phosphotyrosine-binding domain (PTB) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000015444   Gene: ENSSHAG00000013165   Transcript: ENSSHAT00000015571
Sequence length 1259
Comment pep:known_by_projection scaffold:DEVIL7.0:GL864853.1:1179038:1382090:-1 gene:ENSSHAG00000013165 transcript:ENSSHAT00000015571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPITFTAKKYAFPSEISVDFGLQLVGSLPVHSLTTMPMLPWVVAEVRRFSTERPKKEPV
ASQVRLCVSPAFLKCEPDPGKSQQWDPLICSSIFEYKPQQVHKLIHNSQDPSYFACLIKE
DTASQQSICYVFKADDQTKVPEIISSIRQAGKIARQEEFHSQSEFDDTFAKKFEVLFCGR
VTVAHKKAPPALIDECIEKFNHVSCSRKAELDLPSQNSAAPERKPMRKSLSQPGLRSLAF
RKEFQDAGHRSSSFFGGSFEENDIQSHLISGHNIVQPTDIEENRTMLFTVKNNVKHLISN
EKIPASGHKNLGGVCMCVKGIRHVDHFGFICRESSENGGFHFVCYVFQCTNEALVDEIMM
TLKQAFTVAAVQQTSRTPAQQCEGCPLQGLHRLCEKIEGMSSSKTKLELQKHLTTLSNQE
QAAIFEEVQKIRPRNEQKENELVISFLRCLYEEKQKDHVHIGEGKQASQIAAETVRNELP
SSAARFRLDMLKSKAKRSLTESLESILSRGSKARGLPEPSGSVDLDSSGSSTFSNASKEL
SVGEKETLPLPEGSFQHLESSVDLSSDSESPLTEEAAEPSPRQDFRRRANTLSHYPLEAQ
VSPEPPEASPGTAQRRLMRYHSVGTETPHEPNLNPPVDESKSCSGQSSAPALPPPRLNPS
ASSPNFLKCLKHNSSGEQSGNAVPKSISYRNALRKKLHSSSSVPNFLKFLAPVDENNTSD
FRNTKRDYESKTQHHDGSSESPLKTRRHSWRQQIFLRVATPQKGCDSPSRYEDYSELGDL
PPRSPLEPVCEDGPFGPVIEEKKRTSRELRELWKKAILQQILLLRMEKENQKLQASENDL
QNKRLKLDYEEITPCLKDVTSVWEKMLSTPGRSKIKFDMEKMHSAVGQGVPRHHRGEIWK
FLAEQYHLRHQYPSSKQQPKDVPYKELLKQLTSHQHAILIDLGRTFPTHPYFSAQLGAGQ
LSLYNILKAYSLLDQEVGYCQGLSFVAGVLLLHMSEEDAFKMLKFLMFDMGLRKQYRPDM
IILQIQMYQLSRLLHDYHRDLYNHLEEHEICPSLYAAPWFLTMFASQFPLGFVARVFDML
FLQGSEVIFKVALSLLGSHKPLILQHENLENIVEFIKNTLPNLGLVQMEKTINQVFEMDI
SRQLQAYEVEYHVLQDELIDSSPLSDNQRMDKLEKTNSSLRKQNLDLLEELQVANGRIHS
LEATIEILLASEDKLKQTALALELERAALLQTVEKLQKKAAELGNGDPGLAEPELQRDN
Download sequence
Identical sequences G3WJ39
ENSSHAP00000015444 ENSSHAP00000015444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]