SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000015781 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000015781
Domain Number 1 Region: 78-432
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.06e-83
Family Protein kinases, catalytic subunit 0.000000366
Further Details:      
 
Domain Number 2 Region: 2-75
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.79e-17
Family Regulator of G-protein signaling, RGS 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000015781   Gene: ENSSHAG00000013446   Transcript: ENSSHAT00000015910
Sequence length 484
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834460.1:1236804:1338906:-1 gene:ENSSHAG00000013446 transcript:ENSSHAT00000015910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKYLTPESPEYVTEVNQDLIHQTKEKLELRPCKELFSHCAKSVLDYLSGEPFQEYLESMY
FDRFLQWKWLERQPVTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKRLEKKRIKKRK
GESMALNEKQILEKVNSQFVVNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGNPGFEEE
RALFYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEGDLIQGRV
GTVGYMAPEVLNNQRYGLSPDYWGLGCLIFEMIAGQSPFRGRKEKVKREEVDRRVLETEE
VYSHKFSEEAKSICKMLLAKDAKQRLGCREEGAMEVKGHPFFRNMNFKRLEAGMLDPPFV
PDPRAVYCKDVLDIEQFSTVKGVNLDHTDDDFYSKFSTGSVSIPWQNEMIETECFKELNV
FGPNGTLSPDLNRSYPPEPPKKGLLHRIFKRQHQNNSKSTTNSKANFNHHINSNHVRSNS
TGSS
Download sequence
Identical sequences G3WK26
ENSSHAP00000015781 ENSSHAP00000015781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]